You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11724
Secondary Accession Numbers None
Name ATP-dependent RNA helicase DDX39A
Synonyms
  1. DEAD box protein 39
  2. Nuclear RNA helicase URH49
Gene Name DDX39A
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Involved in pre-mRNA splicing. Required for the export of mRNA out of the nucleus.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphoric acid details
GO Classification
Biological Process
mRNA export from nucleus
mRNA splicing, via spliceosome
Cellular Component
cytoplasm
nucleus
Molecular Function
nucleic acid binding
ATP binding
ATP-dependent helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19p13.12
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 49129.15
Theoretical pI 5.676
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|21040371|ref|NP_005795.2| ATP-dependent RNA helicase DDX39A [Homo sapiens]
MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIV
DCGFEHPSEV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O00148
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17821
References
General References Not Available