Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11754
Secondary Accession Numbers None
Name Probable glutathione peroxidase 8
Synonyms
  1. GPx-8
  2. GSHPx-8
Gene Name GPX8
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions
Glutathione + Hydrogen peroxide → Oxidized glutathione + Water details
GO Classification
Biological Process
response to oxidative stress
Cellular Component
integral to membrane
Molecular Function
glutathione peroxidase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q11.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 23880.83
Theoretical pI 9.353
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|192455698|ref|NP_001008398.2| probable glutathione peroxidase 8 [Homo sapiens]
MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTV
SLEKYKGKVS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8TED1
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:33100
References
General References Not Available