Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11763
Secondary Accession Numbers None
Name Solute carrier family 2, facilitated glucose transporter member 14
Synonyms
  1. Glucose transporter type 14
  2. GLUT-14
Gene Name SLC2A14
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Facilitative glucose transporter (By similarity). May have a specific function related to spermatogenesis.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
multicellular organismal development
spermatogenesis
glucose transport
cell differentiation
Cellular Component
integral to membrane
Molecular Function
glucose transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12p13.31
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 56319.575
Theoretical pI 7.82
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|23592238|ref|NP_703150.1| solute carrier family 2, facilitated glucose transporter member 14 [Homo sapiens]
MEFHNGGHVSGIGGFLVSLTSRMKPHTLAVTPALIFAITVATIGSFQFGYNTGVINAPET
IIKEFINKTL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8TDB8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18301
References
General References Not Available