You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Solute carrier family 2, facilitated glucose transporter member 3 (HMDBP11764)
Identification | ||||||||
---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11764 | |||||||
Secondary Accession Numbers | None | |||||||
Name | Solute carrier family 2, facilitated glucose transporter member 3 | |||||||
Synonyms |
|
|||||||
Gene Name | SLC2A3 | |||||||
Protein Type | Unknown | |||||||
Biological Properties | ||||||||
General Function | Not Available | |||||||
Specific Function | Facilitative glucose transporter. Probably a neuronal glucose transporter. | |||||||
Pathways | Not Available | |||||||
Reactions | Not Available | |||||||
GO Classification |
|
|||||||
Cellular Location | Not Available | |||||||
Gene Properties | ||||||||
Chromosome Location | 12 | |||||||
Locus | 12p13.3 | |||||||
SNPs | Not Available | |||||||
Gene Sequence | Not Available | |||||||
Protein Properties | ||||||||
Number of Residues | Not Available | |||||||
Molecular Weight | 53923.785 | |||||||
Theoretical pI | 7.198 | |||||||
Pfam Domain Function | Not Available | |||||||
Signals | Not Available | |||||||
Transmembrane Regions | Not Available | |||||||
Protein Sequence |
>>gi|5902090|ref|NP_008862.1| solute carrier family 2, facilitated glucose transporter member 3 [Homo sapiens] MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLT SLWSLSVAIF |
|||||||
External Links | ||||||||
GenBank ID Protein | Not Available | |||||||
UniProtKB/Swiss-Prot ID | P11169 | |||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||
PDB IDs | Not Available | |||||||
GenBank Gene ID | Not Available | |||||||
GeneCard ID | Not Available | |||||||
GenAtlas ID | Not Available | |||||||
HGNC ID | HGNC:11007 | |||||||
References | ||||||||
General References | Not Available |