You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11768
Secondary Accession Numbers None
Name Solute carrier family 2, facilitated glucose transporter member 7
Synonyms
  1. Glucose transporter type 7
  2. GLUT-7
Gene Name SLC2A7
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function High-affinity transporter for glucose and fructose Does not transport galactose, 2-deoxy-d-glucose and xylose.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
carbohydrate transport
transmembrane transport
Cellular Component
plasma membrane
integral to membrane
Molecular Function
substrate-specific transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p36.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 55726.915
Theoretical pI 8.41
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|134053883|ref|NP_997303.2| solute carrier family 2, facilitated glucose transporter member 7 [Homo sapiens]
MENKEAGTPPPIPSREGRLQPTLLLATLSAAFGSAFQYGYNLSVVNTPHKVFKSFYNETY
FERHATFMDG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6PXP3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:13445
References
General References Not Available