Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11775
Secondary Accession Numbers None
Name Very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 4
Synonyms
  1. 3-hydroxyacyl-CoA dehydratase 4
  2. Protein tyrosine phosphatase-like protein PTPLAD2
  3. Protein-tyrosine phosphatase-like A domain-containing protein 2
  4. HACD4
Gene Name PTPLAD2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Responsible for the dehydration step in very long-chain fatty acid (VLCFA) synthesis.
Pathways Not Available
Reactions
A very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] → a very-long-chain trans-2,3-dehydroacyl-[acyl-carrier protein] + Water details
GO Classification
Biological Process
fatty acid biosynthetic process
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Molecular Function
lyase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus 9p21.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 27519.565
Theoretical pI 8.579
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|148226324|ref|NP_001010915.2| very-long-chain (3R)-3-hydroxyacyl-[acyl-carrier protein] dehydratase 4 [Homo sapiens]
MGPLALPAWLQPRYRKNAYLFIYYLIQFCGHSWIFTNMTVRFFSFGKDSMVDTFYAIGLV
MRLCQSVSLL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q5VWC8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20920
References
General References Not Available