Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11782
Secondary Accession Numbers None
Name Heparan-alpha-glucosaminide N-acetyltransferase
Synonyms
  1. Transmembrane protein 76
Gene Name HGSNAT
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Lysosomal acetyltransferase that acetylates the non-reducing terminal alpha-glucosamine residue of intralysosomal heparin or heparan sulfate, converting it into a substrate for luminal alpha-N-acetyl glucosaminidase.
Pathways
  • Glycosaminoglycan degradation
  • Lysosome
Reactions
Acetyl-CoA + heparan sulfate alpha-D-glucosaminide → Coenzyme A + heparan sulfate N-acetyl-alpha-D-glucosaminide details
Acetyl-CoA + → Coenzyme A + details
GO Classification
Biological Process
small molecule metabolic process
protein oligomerization
glycosaminoglycan catabolic process
carbohydrate metabolic process
lysosomal transport
Cellular Component
lysosomal membrane
integral to membrane
Molecular Function
heparan-alpha-glucosaminide N-acetyltransferase activity
transferase activity, transferring acyl groups
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus 8p11.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 70495.57
Theoretical pI 8.003
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|150378452|ref|NP_689632.2| heparan-alpha-glucosaminide N-acetyltransferase precursor [Homo sapiens]
MSGAGRALAALLLAASVLSAALLAPGGSSGRDAQAAPPRDLDKKRHAELKMDQALLLIHN
ELLWTNLTVY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q68CP4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26527
References
General References Not Available