You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11783
Secondary Accession Numbers None
Name Putative hexokinase HKDC1
Synonyms
  1. Hexokinase domain-containing protein 1
Gene Name HKDC1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways
  • Amino sugar and nucleotide sugar metabolism
  • Butirosin and neomycin biosynthesis
  • Carbohydrate digestion and absorption
  • Fructose and mannose metabolism
  • Galactose metabolism
  • Glycolysis / Gluconeogenesis
  • hexose metabolism
  • HIF-1 signaling pathway
  • Insulin signaling pathway
  • Starch and sucrose metabolism
  • Type II diabetes mellitus
Reactions
Adenosine triphosphate + D-Galactose → ADP + Glucose 6-phosphate details
Adenosine triphosphate + D-Glucose → ADP + Glucose 6-phosphate details
Adenosine triphosphate + D-Fructose → ADP + Beta-D-Fructose 6-phosphate details
Adenosine triphosphate + D-Mannose → ADP + Mannose 6-phosphate details
Adenosine triphosphate + Beta-D-Glucose → ADP + Beta-D-Glucose 6-phosphate details
Adenosine triphosphate + Alpha-D-Glucose → ADP + Glucose 6-phosphate details
Adenosine triphosphate + Glucosamine → ADP + Glucosamine 6-phosphate details
Adenosine triphosphate + D-Fructose → ADP + Beta-D-Fructose 6-phosphate details
GO Classification
Biological Process
glycolysis
cellular glucose homeostasis
Cellular Component
cytosol
mitochondrion
nucleus
Molecular Function
ATP binding
fructokinase activity
glucokinase activity
mannokinase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 10
Locus 10q22.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 102513.88
Theoretical pI 7.24
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|156151420|ref|NP_079406.3| putative hexokinase HKDC1 [Homo sapiens]
MFAVHLMAFYFSKLKEDQIKKVDRFLYHMRLSDDTLLDIMRRFRAEMEKGLAKDTNPTAA
VKMLPTFVRA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q2TB90
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:23302
References
General References Not Available