You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11793
Secondary Accession Numbers None
Name Eukaryotic initiation factor 4A-I
Synonyms
  1. eIF-4A-I
  2. eIF4A-I
  3. ATP-dependent RNA helicase eIF4A-1
Gene Name EIF4A1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function ATP-dependent RNA helicase which is a subunit of the eIF4F complex involved in cap recognition and is required for mRNA binding to ribosome. In the current model of translation initiation, eIF4A unwinds RNA secondary structures in the 5'-UTR of mRNAs which is necessary to allow efficient binding of the small ribosomal subunit, and subsequent scanning for the initiator codon.
Pathways
  • RNA transport
Reactions
Adenosine triphosphate + Water → ADP + Phosphoric acid details
GO Classification
Biological Process
organ regeneration
nuclear-transcribed mRNA poly(A) tail shortening
virus-host interaction
cytokine-mediated signaling pathway
translational initiation
Cellular Component
cytosol
eukaryotic translation initiation factor 4F complex
Molecular Function
ATP binding
RNA cap binding
translation factor activity, nucleic acid binding
ATP-dependent helicase activity
translation initiation factor activity
mRNA binding
helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17p13
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 39548.13
Theoretical pI 5.823
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|325197164|ref|NP_001191439.1| eukaryotic initiation factor 4A-I isoform 2 [Homo sapiens]
MSASQDSRSRDNGPDGMEPEGVIESNWNEIVDSFDDMNLSESLLRGIYAYGFEKPSAIQQ
RAILPCIKGY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P60842
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:3282
References
General References Not Available