You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11799
Secondary Accession Numbers None
Name Adenylate kinase 8
Synonyms Not Available
Gene Name AK8
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Adenylate kinase. Has highest activity toward AMP, and weaker activity toward dAMP, CMP and dCMP.
Pathways Not Available
Reactions
Adenosine triphosphate + Adenosine monophosphate → ADP details
GO Classification
Cellular Component
cytosol
Molecular Function
ATP binding
adenylate kinase activity
cytidylate kinase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus 9q34.13
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 54925.01
Theoretical pI 6.147
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|22749187|ref|NP_689785.1| adenylate kinase 8 [Homo sapiens]
MDATIAPHRIPPEMPQYGEENHIFELMQNMLEQLLIHQPEDPIPFMIQHLHRDNDNVPRI
VILGPPASGK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96MA6
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26526
References
General References Not Available