You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Adenylate kinase 8 (HMDBP11799)
Identification | |||||||
---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11799 | ||||||
Secondary Accession Numbers | None | ||||||
Name | Adenylate kinase 8 | ||||||
Synonyms | Not Available | ||||||
Gene Name | AK8 | ||||||
Protein Type | Unknown | ||||||
Biological Properties | |||||||
General Function | Not Available | ||||||
Specific Function | Adenylate kinase. Has highest activity toward AMP, and weaker activity toward dAMP, CMP and dCMP. | ||||||
Pathways | Not Available | ||||||
Reactions |
|
||||||
GO Classification |
|
||||||
Cellular Location | Not Available | ||||||
Gene Properties | |||||||
Chromosome Location | 9 | ||||||
Locus | 9q34.13 | ||||||
SNPs | Not Available | ||||||
Gene Sequence | Not Available | ||||||
Protein Properties | |||||||
Number of Residues | Not Available | ||||||
Molecular Weight | 54925.01 | ||||||
Theoretical pI | 6.147 | ||||||
Pfam Domain Function | Not Available | ||||||
Signals | Not Available | ||||||
Transmembrane Regions | Not Available | ||||||
Protein Sequence |
>>gi|22749187|ref|NP_689785.1| adenylate kinase 8 [Homo sapiens] MDATIAPHRIPPEMPQYGEENHIFELMQNMLEQLLIHQPEDPIPFMIQHLHRDNDNVPRI VILGPPASGK |
||||||
External Links | |||||||
GenBank ID Protein | Not Available | ||||||
UniProtKB/Swiss-Prot ID | Q96MA6 | ||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
PDB IDs | Not Available | ||||||
GenBank Gene ID | Not Available | ||||||
GeneCard ID | Not Available | ||||||
GenAtlas ID | Not Available | ||||||
HGNC ID | HGNC:26526 | ||||||
References | |||||||
General References | Not Available |