You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Mitochondrial pyruvate carrier 2 (HMDBP11835)
Identification | |||||||
---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11835 | ||||||
Secondary Accession Numbers | None | ||||||
Name | Mitochondrial pyruvate carrier 2 | ||||||
Synonyms |
|
||||||
Gene Name | MPC2 | ||||||
Protein Type | Unknown | ||||||
Biological Properties | |||||||
General Function | Not Available | ||||||
Specific Function | Mediates the uptake of pyruvate into mitochondria. | ||||||
Pathways | Not Available | ||||||
Reactions | Not Available | ||||||
GO Classification |
|
||||||
Cellular Location | Not Available | ||||||
Gene Properties | |||||||
Chromosome Location | 1 | ||||||
Locus | 1q24 | ||||||
SNPs | Not Available | ||||||
Gene Sequence | Not Available | ||||||
Protein Properties | |||||||
Number of Residues | Not Available | ||||||
Molecular Weight | 14278.74 | ||||||
Theoretical pI | 10.435 | ||||||
Pfam Domain Function | Not Available | ||||||
Signals | Not Available | ||||||
Transmembrane Regions | Not Available | ||||||
Protein Sequence |
>>gi|219521872|ref|NP_001137146.1| mitochondrial pyruvate carrier 2 [Homo sapiens] MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADM ARPAEKLSTA |
||||||
External Links | |||||||
GenBank ID Protein | Not Available | ||||||
UniProtKB/Swiss-Prot ID | O95563 | ||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
PDB IDs | Not Available | ||||||
GenBank Gene ID | Not Available | ||||||
GeneCard ID | Not Available | ||||||
GenAtlas ID | Not Available | ||||||
HGNC ID | HGNC:24515 | ||||||
References | |||||||
General References | Not Available |