Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11849
Secondary Accession Numbers None
Name N-acetylaspartate synthetase
Synonyms
  1. NAA synthetase
  2. Camello-like protein 3
  3. N-acetyltransferase 8-like protein
Gene Name NAT8L
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Plays a role in the regulation of lipogenesis by producing N-acetylaspartate acid (NAA), a brain-specific metabolite. NAA occurs in high concentration in brain and its hydrolysis plays a significant part in the maintenance of intact white matter. Promotes dopamine uptake by regulating TNF-alpha expression. Attenuates methamphetamine-induced inhibition of dopamine uptake.
Pathways Not Available
Reactions
Acetyl-CoA + L-Aspartic acid → Coenzyme A + N-Acetyl-L-aspartic acid details
GO Classification
Biological Process
positive regulation of dopamine uptake involved in synaptic transmission
Cellular Component
mitochondrial membrane
rough endoplasmic reticulum membrane
integral to membrane
Molecular Function
aspartate N-acetyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4p16.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 32836.875
Theoretical pI 8.821
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|263192221|ref|NP_848652.2| N-acetylaspartate synthetase [Homo sapiens]
MHCGPPDMVCETKIVAAEDHEALPGAKKDALLAAAGAMWPPLPAAPGPAAAPPAPPPAPV
AQPHGGAGGA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8N9F0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26742
References
General References Not Available