You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11853
Secondary Accession Numbers None
Name Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1
Synonyms
  1. Glucosaminyl N-deacetylase/N-sulfotransferase 1
  2. N-heparan sulfate sulfotransferase 1
  3. [Heparan sulfate]-glucosamine N-sulfotransferase 1
  4. NDST-1
  5. N-HSST 1
  6. HSNST 1
Gene Name NDST1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence is absolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L-selectin ligands, thereby playing a role in inflammatory response.
Pathways
  • Glycosaminoglycan biosynthesis - heparan sulfate / heparin
  • heparan sulfate biosynthesis
  • heparin biosynthesis
Reactions
Phosphoadenosine phosphosulfate + [heparan sulfate]-glucosamine → Adenosine 3',5'-diphosphate + [heparan sulfate]-N-sulfoglucosamine details
GO Classification
Biological Process
heparan sulfate proteoglycan biosynthetic process
glycosaminoglycan biosynthetic process
inflammatory response
respiratory gaseous exchange
heparin biosynthetic process
embryonic neurocranium morphogenesis
polysaccharide biosynthetic process
smoothened signaling pathway
MAPK cascade
embryonic viscerocranium morphogenesis
midbrain development
carbohydrate metabolic process
forebrain development
fibroblast growth factor receptor signaling pathway
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
deacetylase activity
[heparan sulfate]-glucosamine N-sulfotransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q33.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 100867.015
Theoretical pI 7.978
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|4505351|ref|NP_001534.1| bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 [Homo sapiens]
MPALACLRRLCRHVSPQAVLFLLFIFCLFSVFISAYYLYGWKRGLEPSADAPEPDCGDPP
PVAPSRLLPL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P52848
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:7680
References
General References Not Available