You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11862
Secondary Accession Numbers None
Name Omega-amidase NIT2
Synonyms
  1. Nitrilase homolog 2
Gene Name NIT2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Has a omega-amidase activity. The role of omega-amidase is to remove potentially toxic intermediates by converting alpha-ketoglutaramate and alpha-ketosuccinamate to biologically useful alpha-ketoglutarate and oxaloacetate, respectively. Overexpression decreases the colony-forming capacity of cultured cells by arresting cells in the G2 phase of the cell cycle.
Pathways
  • Alanine, aspartate and glutamate metabolism
Reactions
A monoamide of a dicarboxylic acid + Water → a dicarboxylate + Ammonia details
2-Keto-glutaramic acid + Water → Oxoglutaric acid + Ammonia details
2-Oxosuccinamate + Water → Oxalacetic acid + Ammonia details
GO Classification
Biological Process
nitrogen compound metabolic process
Cellular Component
centrosome
cytoplasm
mitochondrion
Molecular Function
omega-amidase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus 3q12.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 30607.645
Theoretical pI 7.212
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|9910460|ref|NP_064587.1| omega-amidase NIT2 [Homo sapiens]
MTSFRLALIQLQISSIKSDNVTRACSFIREAATQGAKIVSLPECFNSPYGAKYFPEYAEK
IPGESTQKLS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NQR4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:29878
References
General References Not Available