Showing Protein Nitrogen permease regulator 2-like protein (HMDBP11865)
| Identification | |||||||
|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11865 | ||||||
| Secondary Accession Numbers | None | ||||||
| Name | Nitrogen permease regulator 2-like protein | ||||||
| Synonyms |
|
||||||
| Gene Name | NPRL2 | ||||||
| Protein Type | Unknown | ||||||
| Biological Properties | |||||||
| General Function | Not Available | ||||||
| Specific Function | Suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. Down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. May act as a tumor suppressor. Suppresses cell growth and enhanced sensitivity to various anticancer drugs. | ||||||
| Pathways | Not Available | ||||||
| Reactions | Not Available | ||||||
| GO Classification |
|
||||||
| Cellular Location | Not Available | ||||||
| Gene Properties | |||||||
| Chromosome Location | 3 | ||||||
| Locus | 3p21.3 | ||||||
| SNPs | Not Available | ||||||
| Gene Sequence | Not Available | ||||||
| Protein Properties | |||||||
| Number of Residues | Not Available | ||||||
| Molecular Weight | 43658.085 | ||||||
| Theoretical pI | 6.528 | ||||||
| Pfam Domain Function |
|
||||||
| Signals | Not Available | ||||||
| Transmembrane Regions | Not Available | ||||||
| Protein Sequence |
>>gi|50592992|ref|NP_006536.3| nitrogen permease regulator 2-like protein [Homo sapiens] MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPELQNKLITVTAM EKKLIGCPVC |
||||||
| External Links | |||||||
| GenBank ID Protein | Not Available | ||||||
| UniProtKB/Swiss-Prot ID | Q8WTW4 | ||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
| PDB IDs | Not Available | ||||||
| GenBank Gene ID | Not Available | ||||||
| GeneCard ID | Not Available | ||||||
| GenAtlas ID | Not Available | ||||||
| HGNC ID | HGNC:24969 | ||||||
| References | |||||||
| General References | Not Available | ||||||