You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11878
Secondary Accession Numbers None
Name Geranylgeranyl transferase type-2 subunit alpha
Synonyms
  1. Geranylgeranyl transferase type II subunit alpha
  2. Rab geranyl-geranyltransferase subunit alpha
  3. Rab geranylgeranyltransferase subunit alpha
  4. Rab GG transferase alpha
  5. Rab GGTase alpha
Gene Name RABGGTA
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.
Pathways Not Available
Reactions
Geranylgeranyl-PP + protein-cysteine → S-geranylgeranyl-protein + Pyrophosphate details
GO Classification
Biological Process
protein geranylgeranylation
cellular protein modification process
visual perception
Molecular Function
Rab geranylgeranyltransferase activity
metal ion binding
zinc ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location 14
Locus 14q11.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 65071.06
Theoretical pI 5.667
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|53828918|ref|NP_004572.3| geranylgeranyl transferase type-2 subunit alpha [Homo sapiens]
MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANP
DFATLWNCRR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q92696
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:9795
References
General References Not Available