You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11882
Secondary Accession Numbers None
Name Pirin
Synonyms
  1. Probable quercetin 2,3-dioxygenase PIR
  2. Probable quercetinase
Gene Name PIR
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Possible transcriptional coregulator. May contribute to the regulation of cellular processes via its interaction with BCL3. May be required for efficient terminal myeloid maturation of hematopoietic cells. May play a role in the regulation of cell migration. May promote apoptosis when overexpressed. Has quercetin 2,3-dioxygenase activity (in vitro).
Pathways
  • quercetin degradation
Reactions
Quercetin + Oxygen → 2-(3,4-Dihydroxybenzoyloxy)-4,6-dihydroxybenzoate + CO + Hydrogen Ion details
GO Classification
Biological Process
transcription from RNA polymerase II promoter
monocyte differentiation
Cellular Component
cytoplasm
nucleus
Molecular Function
metal ion binding
quercetin 2,3-dioxygenase activity
transcription cofactor activity
Cellular Location Not Available
Gene Properties
Chromosome Location X
Locus Xp22.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 32113.195
Theoretical pI 6.922
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|66363697|ref|NP_001018119.1| pirin [Homo sapiens]
MGSSKKVTLSVLSREQSEGVGARVRRSIGRPELKNLDPFLLFDEFKGGRPGGFPDHPHRG
FETVSYLLEG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O00625
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:30048
References
General References Not Available