Hmdb loader
Survey
Identification
HMDB Protein ID HMDBP11928
Secondary Accession Numbers None
Name Regulator of telomere elongation helicase 1
Synonyms
  1. Novel helicase-like
Gene Name RTEL1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function ATP-dependent DNA helicase required to suppress inappropriate homologous recombination, thereby playing a central role DNA repair and in the maintenance of genomic stability. Antagonizes homologous recombination by promoting the disassembly of D loop recombination intermediates. Also required to regulate telomere length; probably due to its anti-recombinase function.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
DNA repair
telomere maintenance
regulation of double-strand break repair via homologous recombination
Cellular Component
nucleus
Molecular Function
metal ion binding
ATP binding
4 iron, 4 sulfur cluster binding
ATP-dependent DNA helicase activity
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 20
Locus 20q13.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 133681.63
Theoretical pI 8.298
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|7706541|ref|NP_057518.1| regulator of telomere elongation helicase 1 isoform 1 [Homo sapiens]
MPKIVLNGVTVDFPFQPYKCQQEYMTKVLECLQQKVNGILESPTGTGKTLCLLCTTLAWR
EHLRDGISAR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NZ71
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:15888
References
General References Not Available