Showing Protein Zinc transporter ZIP1 (HMDBP11934)
Identification | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11934 | |||||||||
Secondary Accession Numbers | None | |||||||||
Name | Zinc transporter ZIP1 | |||||||||
Synonyms |
|
|||||||||
Gene Name | SLC39A1 | |||||||||
Protein Type | Unknown | |||||||||
Biological Properties | ||||||||||
General Function | Not Available | |||||||||
Specific Function | Mediates zinc uptake. May function as a major endogenous zinc uptake transporter in many cells of the body. Responsible for the rapid uptake and accumulation of physiologically effective zinc in prostate cells. | |||||||||
Pathways | Not Available | |||||||||
Reactions | Not Available | |||||||||
GO Classification |
|
|||||||||
Cellular Location | Not Available | |||||||||
Gene Properties | ||||||||||
Chromosome Location | 1 | |||||||||
Locus | 1q21 | |||||||||
SNPs | Not Available | |||||||||
Gene Sequence | Not Available | |||||||||
Protein Properties | ||||||||||
Number of Residues | Not Available | |||||||||
Molecular Weight | 34249.215 | |||||||||
Theoretical pI | 5.922 | |||||||||
Pfam Domain Function | Not Available | |||||||||
Signals | Not Available | |||||||||
Transmembrane Regions | Not Available | |||||||||
Protein Sequence |
>>gi|430768587|ref|NP_001258886.1| zinc transporter ZIP1 isoform a [Homo sapiens] MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHE GSASRQKALS |
|||||||||
External Links | ||||||||||
GenBank ID Protein | Not Available | |||||||||
UniProtKB/Swiss-Prot ID | Q9NY26 | |||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
PDB IDs | Not Available | |||||||||
GenBank Gene ID | Not Available | |||||||||
GeneCard ID | Not Available | |||||||||
GenAtlas ID | Not Available | |||||||||
HGNC ID | HGNC:12876 | |||||||||
References | ||||||||||
General References | Not Available |