You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11937
Secondary Accession Numbers None
Name Zinc transporter ZIP4
Synonyms
  1. Solute carrier family 39 member 4
  2. Zrt- and Irt-like protein 4
  3. ZIP-4
Gene Name SLC39A4
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Plays an important role in cellular zinc homeostasis as a zinc transporter. Regulated in response to zinc availability (By similarity).
Pathways
  • Mineral absorption
Reactions Not Available
GO Classification
Biological Process
cellular response to zinc ion starvation
cellular zinc ion homeostasis
transmembrane transport
Cellular Component
plasma membrane
recycling endosome membrane
apical plasma membrane
integral to membrane
cytoplasmic membrane-bounded vesicle
Molecular Function
zinc ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus 8q24.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 66161.175
Theoretical pI 5.51
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|115430259|ref|NP_060237.2| zinc transporter ZIP4 isoform 1 [Homo sapiens]
MVDVVGLERETGPRGSPWPGLPLPSLVGPAPLLTCLCPQCLSVEDALGLGEPEGSGLPPG
PVLEARYVAR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6P5W5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17129
References
General References Not Available