You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11939
Secondary Accession Numbers None
Name Zinc transporter ZIP6
Synonyms
  1. Estrogen-regulated protein LIV-1
  2. Solute carrier family 39 member 6
  3. Zrt- and Irt-like protein 6
  4. ZIP-6
Gene Name SLC39A6
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function May act as a zinc-influx transporter.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
zinc ion transmembrane import
cellular zinc ion homeostasis
Cellular Component
endoplasmic reticulum
lamellipodium membrane
integral to plasma membrane
Molecular Function
zinc ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 18
Locus 18q12.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 48605.05
Theoretical pI 6.514
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|153252214|ref|NP_001092876.1| zinc transporter ZIP6 isoform 2 [Homo sapiens]
MGIQVPLNATEFNYLCPAIINQIDARSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISII
SFLSLLGVIL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q13433
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18607
References
General References Not Available