You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Zinc transporter ZIP12 (HMDBP11945)
Identification | |||||||
---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11945 | ||||||
Secondary Accession Numbers | None | ||||||
Name | Zinc transporter ZIP12 | ||||||
Synonyms |
|
||||||
Gene Name | SLC39A12 | ||||||
Protein Type | Unknown | ||||||
Biological Properties | |||||||
General Function | Not Available | ||||||
Specific Function | Acts as a zinc-influx transporter (Potential). May be partly involved in the outbreak of schizophrenia. | ||||||
Pathways | Not Available | ||||||
Reactions | Not Available | ||||||
GO Classification |
|
||||||
Cellular Location | Not Available | ||||||
Gene Properties | |||||||
Chromosome Location | 10 | ||||||
Locus | 10p12.33 | ||||||
SNPs | Not Available | ||||||
Gene Sequence | Not Available | ||||||
Protein Properties | |||||||
Number of Residues | Not Available | ||||||
Molecular Weight | 76665.43 | ||||||
Theoretical pI | 6.287 | ||||||
Pfam Domain Function | Not Available | ||||||
Signals | Not Available | ||||||
Transmembrane Regions | Not Available | ||||||
Protein Sequence |
>>gi|223633939|ref|NP_001138667.1| zinc transporter ZIP12 isoform 1 precursor [Homo sapiens] MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVLSAGDHPPHNH SRSLIKTLLE |
||||||
External Links | |||||||
GenBank ID Protein | Not Available | ||||||
UniProtKB/Swiss-Prot ID | Q504Y0 | ||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
PDB IDs | Not Available | ||||||
GenBank Gene ID | Not Available | ||||||
GeneCard ID | Not Available | ||||||
GenAtlas ID | Not Available | ||||||
HGNC ID | HGNC:20860 | ||||||
References | |||||||
General References | Not Available |