You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Zinc transporter ZIP13 (HMDBP11946)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11946 | ||||||||
Secondary Accession Numbers | None | ||||||||
Name | Zinc transporter ZIP13 | ||||||||
Synonyms |
|
||||||||
Gene Name | SLC39A13 | ||||||||
Protein Type | Unknown | ||||||||
Biological Properties | |||||||||
General Function | Not Available | ||||||||
Specific Function | Acts as a zinc-influx transporter. | ||||||||
Pathways | Not Available | ||||||||
Reactions | Not Available | ||||||||
GO Classification |
|
||||||||
Cellular Location | Not Available | ||||||||
Gene Properties | |||||||||
Chromosome Location | 11 | ||||||||
Locus | 11p11.2 | ||||||||
SNPs | Not Available | ||||||||
Gene Sequence | Not Available | ||||||||
Protein Properties | |||||||||
Number of Residues | Not Available | ||||||||
Molecular Weight | 38938.04 | ||||||||
Theoretical pI | 5.443 | ||||||||
Pfam Domain Function | Not Available | ||||||||
Signals | Not Available | ||||||||
Transmembrane Regions | Not Available | ||||||||
Protein Sequence |
>>gi|190014617|ref|NP_001121697.1| zinc transporter ZIP13 isoform a precursor [Homo sapiens] MPGCPCPGCGMAGPRLLFLTALALELLGRAGGSQPALRSRGTATACRLDNKESESWGALL SGERLDTWIC |
||||||||
External Links | |||||||||
GenBank ID Protein | Not Available | ||||||||
UniProtKB/Swiss-Prot ID | Q96H72 | ||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
PDB IDs | Not Available | ||||||||
GenBank Gene ID | Not Available | ||||||||
GeneCard ID | Not Available | ||||||||
GenAtlas ID | Not Available | ||||||||
HGNC ID | HGNC:20859 | ||||||||
References | |||||||||
General References | Not Available |