You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11953
Secondary Accession Numbers None
Name Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1
Synonyms
  1. GalNAc alpha-2,6-sialyltransferase I
  2. ST6GalNAc I
  3. Sialyltransferase 7A
  4. ST6GalNAcI
  5. SIAT7-A
Gene Name ST6GALNAC1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways
  • Mucin type O-Glycan biosynthesis
  • protein glycosylation
Reactions
Cytidine monophosphate N-acetylneuraminic acid + glycano-(1->3)-(N-acetyl-alpha-D-galactosaminyl)-glycoprotein → Cytidine monophosphate + glycano-((2->6)-alpha-N-acetylneuraminyl)-(N-acetyl-D-galactosaminyl)-glycoprotein details
CMP-N-acetylneuraminate + Tn antigen → CMP + Sialyl-Tn antigen details
CMP-N-acetylneuraminate + → CMP + details
GO Classification
Biological Process
oligosaccharide biosynthetic process
protein glycosylation
Cellular Component
integral to Golgi membrane
Molecular Function
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase activity
sialyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17q25.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 68563.845
Theoretical pI 9.92
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|21264332|ref|NP_060884.1| alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 1 [Homo sapiens]
MRSCLWRCRHLSQGVQWSLLLAVLVFFLFALPSFIKEPQTKPSRHQRTENIKERSLQSLA
KPKSQAPTRA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NSC7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:23614
References
General References Not Available