Showing Protein Sugar transporter SWEET1 (HMDBP11968)
| Identification | ||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11968 | |||||||||||||
| Secondary Accession Numbers | None | |||||||||||||
| Name | Sugar transporter SWEET1 | |||||||||||||
| Synonyms |
|
|||||||||||||
| Gene Name | SLC50A1 | |||||||||||||
| Protein Type | Unknown | |||||||||||||
| Biological Properties | ||||||||||||||
| General Function | Not Available | |||||||||||||
| Specific Function | Mediates sugar transport across membranes. May stimulate V(D)J recombination by the activation of RAG1. | |||||||||||||
| Pathways | Not Available | |||||||||||||
| Reactions | Not Available | |||||||||||||
| GO Classification |
|
|||||||||||||
| Cellular Location | Not Available | |||||||||||||
| Gene Properties | ||||||||||||||
| Chromosome Location | 1 | |||||||||||||
| Locus | 1q22 | |||||||||||||
| SNPs | Not Available | |||||||||||||
| Gene Sequence | Not Available | |||||||||||||
| Protein Properties | ||||||||||||||
| Number of Residues | Not Available | |||||||||||||
| Molecular Weight | 19050.135 | |||||||||||||
| Theoretical pI | 9.247 | |||||||||||||
| Pfam Domain Function |
|
|||||||||||||
| Signals | Not Available | |||||||||||||
| Transmembrane Regions | Not Available | |||||||||||||
| Protein Sequence |
>>gi|170932479|ref|NP_001116309.1| sugar transporter SWEET1 isoform b [Homo sapiens] MRGLHPWHVLRRPLGPQAHANDPECGQRPVPALSHHGSQRVVLLQTATLLGVLLLGYGYF WLLVPNPEAR |
|||||||||||||
| External Links | ||||||||||||||
| GenBank ID Protein | Not Available | |||||||||||||
| UniProtKB/Swiss-Prot ID | Q9BRV3 | |||||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||||
| PDB IDs | Not Available | |||||||||||||
| GenBank Gene ID | Not Available | |||||||||||||
| GeneCard ID | Not Available | |||||||||||||
| GenAtlas ID | Not Available | |||||||||||||
| HGNC ID | HGNC:30657 | |||||||||||||
| References | ||||||||||||||
| General References | Not Available | |||||||||||||