You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11971
Secondary Accession Numbers None
Name Transitional endoplasmic reticulum ATPase
Synonyms
  1. TER ATPase
  2. 15S Mg(2+)-ATPase p97 subunit
  3. Valosin-containing protein
  4. VCP
Gene Name VCP
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Necessary for the fragmentation of Golgi stacks during mitosis and for their reassembly after mitosis. Involved in the formation of the transitional endoplasmic reticulum (tER). The transfer of membranes from the endoplasmic reticulum to the Golgi apparatus occurs via 50-70 nm transition vesicles which derive from part-rough, part-smooth transitional elements of the endoplasmic reticulum (tER). Vesicle budding from the tER is an ATP-dependent process. The ternary complex containing UFD1L, VCP and NPLOC4 binds ubiquitinated proteins and is necessary for the export of misfolded proteins from the ER to the cytoplasm, where they are degraded by the proteasome. The NPLOC4-UFD1L-VCP complex regulates spindle disassembly at the end of mitosis and is necessary for the formation of a closed nuclear envelope. Regulates E3 ubiquitin-protein ligase activity of RNF19A (By similarity). Component of the VCP/p97-AMFR/gp78 complex that participates in the final step of the sterol-mediated ubiquitination and endoplasmic reticulum-associated degradation (ERAD) of HMGCR. Also involved in DNA damage response: recruited to double-strand breaks (DSBs) sites in a RNF8- and RNF168-dependent manner and promotes the recruitment of TP53BP1 at DNA damage sites. Recruited to stalled replication forks by SPRTN: may act by mediating extraction of DNA polymerase eta (POLH) to prevent excessive translesion DNA synthesis and limit the incidence of mutations induced by DNA damage.
Pathways
  • Legionellosis
  • Protein processing in endoplasmic reticulum
Reactions
Adenosine triphosphate + Water → ADP + Phosphoric acid details
GO Classification
Biological Process
activation of cysteine-type endopeptidase activity involved in apoptotic process
positive regulation of proteasomal ubiquitin-dependent protein catabolic process
ER to Golgi vesicle-mediated transport
double-strand break repair
protein N-linked glycosylation via asparagine
endoplasmic reticulum unfolded protein response
protein homooligomerization
translesion synthesis
ER-associated protein catabolic process
aggresome assembly
positive regulation of protein complex assembly
retrograde protein transport, ER to cytosol
protein ubiquitination
Cellular Component
cytosol
site of double-strand break
endoplasmic reticulum
nucleus
proteasome complex
Molecular Function
lipid binding
ATP binding
ATPase activity
polyubiquitin binding
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus 9p13.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 89320.885
Theoretical pI 5.267
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|6005942|ref|NP_009057.1| transitional endoplasmic reticulum ATPase [Homo sapiens]
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLK
GKKRREAVCI
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P55072
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:12666
References
General References Not Available