You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11976
Secondary Accession Numbers None
Name Acyl-coenzyme A thioesterase THEM4
Synonyms
  1. Acyl-CoA thioesterase THEM4
  2. Carboxyl-terminal modulator protein
  3. Thioesterase superfamily member 4
Gene Name THEM4
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Has acyl-CoA thioesterase activity towards medium and long-chain (C14 to C18) fatty acyl-CoA substrates, and probably plays an role in mitochondrial fatty acid metabolism. Plays a role in the apoptotic process, possibly via its regulation of AKT1 activity. According to PubMed:11598301, inhibits AKT1 phosphorylation and activity. According to PubMed:17615157, enhances AKT1 activity by favoring its phosphorylation and translocation to plasma membrane.
Pathways
  • PI3K-Akt signaling pathway
Reactions
hexadecanoyl-CoA + Water → Coenzyme A + Palmitic acid details
GO Classification
Biological Process
apoptotic process
fatty acid metabolic process
insulin receptor signaling pathway
protein kinase B signaling cascade
phosphatidylinositol-mediated signaling
epidermal growth factor receptor signaling pathway
fibroblast growth factor receptor signaling pathway
nerve growth factor receptor signaling pathway
Cellular Component
cytosol
mitochondrion
plasma membrane
ruffle membrane
mitochondrial inner membrane
mitochondrial intermembrane space
Molecular Function
palmitoyl-CoA hydrolase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1q21
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 27129.375
Theoretical pI 8.273
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|76159293|ref|NP_444283.2| acyl-coenzyme A thioesterase THEM4 [Homo sapiens]
MLRSCAARLRTLGALCLPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPNPSWNKDLRLL
FDQFMKKCED
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q5T1C6
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17947
References
General References Not Available