You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11977
Secondary Accession Numbers None
Name Probable tRNA(His) guanylyltransferase
Synonyms
  1. Interphase cytoplasmic foci protein 45
  2. tRNA-histidine guanylyltransferase
Gene Name THG1L
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage. This step is essential for proper recognition of the tRNA and for the fidelity of protein synthesis.
Pathways Not Available
Reactions
p-tRNA(His) + Adenosine triphosphate + Guanosine triphosphate → pppG-P-tRNA(His) + Adenosine monophosphate + Pyrophosphate details
GO Classification
Biological Process
tRNA modification
protein homotetramerization
Cellular Component
mitochondrion
Molecular Function
magnesium ion binding
ATP binding
GTP binding
tRNA guanylyltransferase activity
tRNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q33.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 34830.605
Theoretical pI 7.994
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|89242148|ref|NP_060342.2| probable tRNA(His) guanylyltransferase [Homo sapiens]
MWGACKVKVHDSLATISITLRRYLRLGATMAKSKFEYVRDFEADDTCLAHCWVVVRLDGR
NFHRFAEKHN
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NWX6
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26053
References
General References Not Available