Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11978
Secondary Accession Numbers None
Name Fructose-2,6-bisphosphatase TIGAR
Synonyms
  1. TP53-induced glycolysis and apoptosis regulator
Gene Name TIGAR
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Fructose-bisphosphatase hydrolyzing fructose-2,6-bisphosphate as well as fructose-1,6-bisphosphate. Inhibits glycolysis by reducing cellular levels of fructose-2,6-bisphosphate. May protect cells against reactive oxygen species and against apoptosis induced by tp53.
Pathways
  • Fructose and mannose metabolism
Reactions
D-Fructose 2,6-bisphosphate + Water → Fructose 6-phosphate + Phosphoric acid details
D-Fructose 2,6-bisphosphate + Water → Beta-D-Fructose 6-phosphate + Phosphoric acid details
GO Classification
Cellular Component
intracellular
Molecular Function
fructose-2,6-bisphosphate 2-phosphatase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12p13.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 30062.295
Theoretical pI 7.691
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|9966849|ref|NP_065108.1| fructose-2,6-bisphosphatase TIGAR [Homo sapiens]
MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLM
RTKQTMHGIL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NQ88
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:1185
References
General References Not Available