Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11992
Secondary Accession Numbers None
Name Ubiquitin-conjugating enzyme E2 H
Synonyms
  1. UbcH2
  2. Ubiquitin carrier protein H
  3. Ubiquitin-conjugating enzyme E2-20K
  4. Ubiquitin-protein ligase H
Gene Name UBE2H
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Capable, in vitro, to ubiquitinate histone H2A.
Pathways
  • protein ubiquitination
  • Ubiquitin mediated proteolysis
Reactions
Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine details
GO Classification
Biological Process
protein K48-linked ubiquitination
ubiquitin-dependent protein catabolic process
protein K11-linked ubiquitination
Molecular Function
ubiquitin-protein ligase activity
ATP binding
Cellular Location Not Available
Gene Properties
Chromosome Location 7
Locus 7q32
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 12859.03
Theoretical pI 4.213
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|321267500|ref|NP_001189427.1| ubiquitin-conjugating enzyme E2 H isoform 3 [Homo sapiens]
MNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMY
LHRPEEYKQK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P62256
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:12484
References
General References Not Available