You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification |
HMDB Protein ID
| HMDBP11993 |
Secondary Accession Numbers
| None |
Name
| Ubiquitin-conjugating enzyme E2 K |
Synonyms
|
- Huntingtin-interacting protein 2
- Ubiquitin carrier protein
- Ubiquitin-conjugating enzyme E2-25 kDa
- Ubiquitin-protein ligase
- HIP-2
- Ubiquitin-conjugating enzyme E2(25K)
- Ubiquitin-conjugating enzyme E2-25K
|
Gene Name
| UBE2K |
Protein Type
| Unknown |
Biological Properties |
General Function
| Not Available |
Specific Function
| Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro, in the presence or in the absence of BRCA1-BARD1 E3 ubiquitin-protein ligase complex, catalyzes the synthesis of 'Lys-48'-linked polyubiquitin chains. Does not transfer ubiquitin directly to but elongates monoubiquitinated substrate protein. Mediates the selective degradation of short-lived and abnormal proteins, such as the endoplasmic reticulum-associated degradation (ERAD) of misfolded lumenal proteins. Ubiquitinates huntingtin. May mediate foam cell formation by the suppression of apoptosis of lipid-bearing macrophages through ubiquitination and subsequence degradation of p53/TP53. Proposed to be involved in ubiquitination and proteolytic processing of NF-kappa-B; in vitro supports ubiquitination of NFKB1. In case of infection by cytomegaloviruses may be involved in the US11-dependent degradation of MHC class I heavy chains following their export from the ER to the cytosol. In case of viral infections may be involved in the HPV E7 protein-dependent degradation of RB1.
|
Pathways
|
- protein ubiquitination
- Ubiquitin mediated proteolysis
|
Reactions
|
Adenosine triphosphate + ubiquitin + protein lysine → Adenosine monophosphate + Pyrophosphate + protein N-ubiquityllysine |
details
|
|
GO Classification
|
Biological Process |
protein K48-linked ubiquitination |
ubiquitin-dependent protein catabolic process |
Cellular Component |
cytoplasm |
Molecular Function |
ATP binding |
ubiquitin-ubiquitin ligase activity |
|
Cellular Location
|
Not Available
|
Gene Properties |
Chromosome Location
| 4 |
Locus
| 4p14 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 16618.01 |
Theoretical pI
| 6.551 |
Pfam Domain Function
|
Not Available |
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>>gi|163660387|ref|NP_001104583.1| ubiquitin-conjugating enzyme E2 K isoform 3 [Homo sapiens]
MANIAVQRIKREFKEVLKSEEVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLL
SLQALLAAAE
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| P61086 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
|
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:4914 |
References |
General References
| Not Available |