You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11997
Secondary Accession Numbers None
Name UDP-glucuronosyltransferase 3A2
Synonyms
  1. UDPGT 3A2
Gene Name UGT3A2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function UDP-glucuronosyltransferases catalyze phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase water solubility and enhance excretion. They are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds (By similarity).
Pathways Not Available
Reactions
Uridine diphosphate glucuronic acid + acceptor → Uridine 5'-diphosphate + acceptor beta-D-glucuronoside details
GO Classification
Cellular Component
integral to membrane
Molecular Function
glucuronosyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5p13.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 55676.76
Theoretical pI 8.154
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|270132420|ref|NP_001161788.1| UDP-glucuronosyltransferase 3A2 isoform 2 precursor [Homo sapiens]
MAGQRVLLLVGFLLPGVLLSEAAKILTISTVDFKKEEKSYQVISWLAPEDHQREFKKSFD
FFLEETLGGR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q3SY77
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:27266
References
General References Not Available