You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Vesicular acetylcholine transporter (HMDBP11999)
Identification | ||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11999 | |||||||||||||
Secondary Accession Numbers | None | |||||||||||||
Name | Vesicular acetylcholine transporter | |||||||||||||
Synonyms |
|
|||||||||||||
Gene Name | SLC18A3 | |||||||||||||
Protein Type | Unknown | |||||||||||||
Biological Properties | ||||||||||||||
General Function | Not Available | |||||||||||||
Specific Function | Involved in acetylcholine transport into synaptic vesicles. | |||||||||||||
Pathways |
|
|||||||||||||
Reactions | Not Available | |||||||||||||
GO Classification |
|
|||||||||||||
Cellular Location | Not Available | |||||||||||||
Gene Properties | ||||||||||||||
Chromosome Location | 10 | |||||||||||||
Locus | 10q11.2 | |||||||||||||
SNPs | Not Available | |||||||||||||
Gene Sequence | Not Available | |||||||||||||
Protein Properties | ||||||||||||||
Number of Residues | Not Available | |||||||||||||
Molecular Weight | 56902.595 | |||||||||||||
Theoretical pI | 6.191 | |||||||||||||
Pfam Domain Function | Not Available | |||||||||||||
Signals | Not Available | |||||||||||||
Transmembrane Regions | Not Available | |||||||||||||
Protein Sequence |
>>gi|118582257|ref|NP_003046.2| vesicular acetylcholine transporter [Homo sapiens] MESAEPAGQARAAATKLSEAVGAALQEPRRQRRLVLVIVCVALLLDNMLYMVIVPIVPDY IAHMRGGGEG |
|||||||||||||
External Links | ||||||||||||||
GenBank ID Protein | Not Available | |||||||||||||
UniProtKB/Swiss-Prot ID | Q16572 | |||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||||
PDB IDs | Not Available | |||||||||||||
GenBank Gene ID | Not Available | |||||||||||||
GeneCard ID | Not Available | |||||||||||||
GenAtlas ID | Not Available | |||||||||||||
HGNC ID | HGNC:10936 | |||||||||||||
References | ||||||||||||||
General References | Not Available |