You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP12005
Secondary Accession Numbers None
Name Vacuolar protein sorting-associated protein 4A
Synonyms
  1. Protein SKD2
  2. VPS4-1
  3. hVPS4
Gene Name VPS4A
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (HIV-1 and other lentiviruses). Involved in cytokinesis.
Pathways
  • Endocytosis
Reactions
Adenosine triphosphate + Water → ADP + Phosphoric acid details
GO Classification
Biological Process
cell cycle
protein transport
cytokinesis
endosomal transport
vesicle-mediated transport
cellular membrane organization
Cellular Component
cytosol
perinuclear region of cytoplasm
late endosome membrane
midbody
Molecular Function
ATP binding
ATPase activity, coupled
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus 16q22.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 48897.45
Theoretical pI 7.794
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|7019569|ref|NP_037377.1| vacuolar protein sorting-associated protein 4A [Homo sapiens]
MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKC
VQYLDRAEKL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UN37
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:13488
References
General References Not Available