You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP12006
Secondary Accession Numbers None
Name Vacuolar protein sorting-associated protein 4B
Synonyms
  1. Cell migration-inducing gene 1 protein
  2. Suppressor of K(+) transport growth defect 1
  3. Protein SKD1
Gene Name VPS4B
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and enveloped virus budding (HIV-1 and other lentiviruses).
Pathways
  • Endocytosis
Reactions
Adenosine triphosphate + Water → ADP + Phosphoric acid details
GO Classification
Biological Process
cell cycle
cell division
protein transport
response to lipid
endosome to lysosome transport via multivesicular body sorting pathway
intracellular cholesterol transport
endosome organization
potassium ion transport
cellular membrane organization
Cellular Component
cytosol
vacuolar membrane
nucleus
early endosome
lysosome
late endosome
late endosome membrane
endosome membrane
Molecular Function
ATP binding
ATPase activity, coupled
Cellular Location Not Available
Gene Properties
Chromosome Location 18
Locus 18q21.33
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 49301.635
Theoretical pI 7.22
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|17865802|ref|NP_004860.2| vacuolar protein sorting-associated protein 4B [Homo sapiens]
MSSTSPNLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRA
KCTEYLDRAE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O75351
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:10895
References
General References Not Available