Showing Protein Palmitoyltransferase ZDHHC18 (HMDBP12018)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP12018 | ||||||||
Secondary Accession Numbers | None | ||||||||
Name | Palmitoyltransferase ZDHHC18 | ||||||||
Synonyms |
|
||||||||
Gene Name | ZDHHC18 | ||||||||
Protein Type | Unknown | ||||||||
Biological Properties | |||||||||
General Function | Not Available | ||||||||
Specific Function | Has palmitoyltransferase activity towards HRAS and LCK (By similarity). | ||||||||
Pathways | Not Available | ||||||||
Reactions |
|
||||||||
GO Classification |
|
||||||||
Cellular Location | Not Available | ||||||||
Gene Properties | |||||||||
Chromosome Location | 1 | ||||||||
Locus | 1p36.11 | ||||||||
SNPs | Not Available | ||||||||
Gene Sequence | Not Available | ||||||||
Protein Properties | |||||||||
Number of Residues | Not Available | ||||||||
Molecular Weight | 42030.225 | ||||||||
Theoretical pI | 9.043 | ||||||||
Pfam Domain Function | Not Available | ||||||||
Signals | Not Available | ||||||||
Transmembrane Regions | Not Available | ||||||||
Protein Sequence |
>>gi|45433499|ref|NP_115659.1| palmitoyltransferase ZDHHC18 [Homo sapiens] MKDCEYQQISPGAAPLPASPGARRPGPAASPTPGPGPAPPAAPAPPRWSSSGSGSGSGSG SLGRRPRRKW |
||||||||
External Links | |||||||||
GenBank ID Protein | Not Available | ||||||||
UniProtKB/Swiss-Prot ID | Q9NUE0 | ||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
PDB IDs | Not Available | ||||||||
GenBank Gene ID | Not Available | ||||||||
GeneCard ID | Not Available | ||||||||
GenAtlas ID | Not Available | ||||||||
HGNC ID | HGNC:20712 | ||||||||
References | |||||||||
General References | Not Available |