You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Palmitoyltransferase ZDHHC2 (HMDBP12026)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP12026 | ||||||||
Secondary Accession Numbers | None | ||||||||
Name | Palmitoyltransferase ZDHHC2 | ||||||||
Synonyms |
|
||||||||
Gene Name | ZDHHC2 | ||||||||
Protein Type | Unknown | ||||||||
Biological Properties | |||||||||
General Function | Not Available | ||||||||
Specific Function | Palmitoyltransferase specific for GAP43 and DLG4/PSD95 (By similarity). | ||||||||
Pathways | Not Available | ||||||||
Reactions |
|
||||||||
GO Classification |
|
||||||||
Cellular Location | Not Available | ||||||||
Gene Properties | |||||||||
Chromosome Location | 8 | ||||||||
Locus | 8p22 | ||||||||
SNPs | Not Available | ||||||||
Gene Sequence | Not Available | ||||||||
Protein Properties | |||||||||
Number of Residues | Not Available | ||||||||
Molecular Weight | 42021.2 | ||||||||
Theoretical pI | 8.357 | ||||||||
Pfam Domain Function | Not Available | ||||||||
Signals | Not Available | ||||||||
Transmembrane Regions | Not Available | ||||||||
Protein Sequence |
>>gi|7705949|ref|NP_057437.1| palmitoyltransferase ZDHHC2 [Homo sapiens] MAPSGPGSSARRRCRRVLYWIPVVFITLLLGWSYYAYAIQLCIVSMENTGEQVVCLMAYH LLFAMFVWSY |
||||||||
External Links | |||||||||
GenBank ID Protein | Not Available | ||||||||
UniProtKB/Swiss-Prot ID | Q9UIJ5 | ||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
PDB IDs | Not Available | ||||||||
GenBank Gene ID | Not Available | ||||||||
GeneCard ID | Not Available | ||||||||
GenAtlas ID | Not Available | ||||||||
HGNC ID | HGNC:18469 | ||||||||
References | |||||||||
General References | Not Available |