You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Palmitoyltransferase ZDHHC5 (HMDBP12029)
| Identification | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP12029 | |||||||||
| Secondary Accession Numbers | None | |||||||||
| Name | Palmitoyltransferase ZDHHC5 | |||||||||
| Synonyms |
|
|||||||||
| Gene Name | ZDHHC5 | |||||||||
| Protein Type | Unknown | |||||||||
| Biological Properties | ||||||||||
| General Function | Not Available | |||||||||
| Specific Function | Palmitoyl acyltransferase for the G-protein coupled receptor SSTR5. Also palmitoylates FLOT2 (By similarity). | |||||||||
| Pathways | Not Available | |||||||||
| Reactions |
|
|||||||||
| GO Classification |
|
|||||||||
| Cellular Location | Not Available | |||||||||
| Gene Properties | ||||||||||
| Chromosome Location | 11 | |||||||||
| Locus | 11q12.1 | |||||||||
| SNPs | Not Available | |||||||||
| Gene Sequence | Not Available | |||||||||
| Protein Properties | ||||||||||
| Number of Residues | Not Available | |||||||||
| Molecular Weight | 77543.97 | |||||||||
| Theoretical pI | 9.007 | |||||||||
| Pfam Domain Function | Not Available | |||||||||
| Signals | Not Available | |||||||||
| Transmembrane Regions | Not Available | |||||||||
| Protein Sequence |
>>gi|41152072|ref|NP_056272.2| palmitoyltransferase ZDHHC5 [Homo sapiens] MPAESGKRFKPSKYVPVSAAAIFLVGATTLFFAFTCPGLSLYVSPAVPIYNAIMFLFVLA NFSMATFMDP |
|||||||||
| External Links | ||||||||||
| GenBank ID Protein | Not Available | |||||||||
| UniProtKB/Swiss-Prot ID | Q9C0B5 | |||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
| PDB IDs | Not Available | |||||||||
| GenBank Gene ID | Not Available | |||||||||
| GeneCard ID | Not Available | |||||||||
| GenAtlas ID | Not Available | |||||||||
| HGNC ID | HGNC:18472 | |||||||||
| References | ||||||||||
| General References | Not Available | |||||||||