You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP12031
Secondary Accession Numbers None
Name Palmitoyltransferase ZDHHC7
Synonyms
  1. Zinc finger DHHC domain-containing protein 7
  2. Zinc finger protein 370
  3. DHHC-7
Gene Name ZDHHC7
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Palmitoyltransferase with broad specificity. Palmitoylates SNAP25 and DLG4/PSD95. May palmitoylate GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3) and thereby regulate their synaptic clustering and/or cell surface stability (By similarity). Palmitoylates sex steroid hormone receptors, including ESR1, PGR and AR, thereby regulating their targeting to the plasma membrane. This affects rapid intracellular signaling by sex hormones via ERK and AKT kinases and the generation of cAMP, but does not affect that mediated by their nuclear receptors.
Pathways Not Available
Reactions
hexadecanoyl-CoA + protein-cysteine → S-palmitoyl protein + Coenzyme A details
GO Classification
Biological Process
peptidyl-L-cysteine S-palmitoylation
Cellular Component
Golgi apparatus
integral to membrane
Molecular Function
metal ion binding
zinc ion binding
palmitoyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus 16q24.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 38916.99
Theoretical pI 7.621
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|224493964|ref|NP_001139020.1| palmitoyltransferase ZDHHC7 isoform 1 [Homo sapiens]
MQPSGHRLRDVEHHPLLAENDNYDSSSSSSSEADVADRVWFIRDGCGMICAVMTWLLVAY
ADFVVTFVML
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NXF8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18459
References
General References Not Available