You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP12032
Secondary Accession Numbers None
Name Probable palmitoyltransferase ZDHHC8
Synonyms
  1. Zinc finger DHHC domain-containing protein 8
  2. Zinc finger protein 378
  3. DHHC-8
Gene Name ZDHHC8
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Palmitoyltransferase involved in glutamatergic transmission. Mediates palmitoylation of ABCA1.
Pathways Not Available
Reactions
hexadecanoyl-CoA + protein-cysteine → S-palmitoyl protein + Coenzyme A details
GO Classification
Biological Process
behavior
Cellular Component
mitochondrion
cytoplasmic vesicle membrane
integral to membrane
Molecular Function
metal ion binding
zinc ion binding
transferase activity, transferring acyl groups
Cellular Location Not Available
Gene Properties
Chromosome Location 22
Locus 22q11.21
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 83171.835
Theoretical pI 9.248
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|297206817|ref|NP_001171953.1| probable palmitoyltransferase ZDHHC8 isoform 1 [Homo sapiens]
MPRSPGTRLKPAKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIFLFVLA
NFSMATFMDP
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9ULC8
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18474
References
General References Not Available