Showing Protein Zinc transporter 4 (HMDBP12039)
Identification | |||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP12039 | ||||||||||||||
Secondary Accession Numbers | None | ||||||||||||||
Name | Zinc transporter 4 | ||||||||||||||
Synonyms |
|
||||||||||||||
Gene Name | SLC30A4 | ||||||||||||||
Protein Type | Unknown | ||||||||||||||
Biological Properties | |||||||||||||||
General Function | Not Available | ||||||||||||||
Specific Function | Probably involved in zinc transport out of the cytoplasm, maybe by sequestration into an intracellular compartment. | ||||||||||||||
Pathways | Not Available | ||||||||||||||
Reactions | Not Available | ||||||||||||||
GO Classification |
|
||||||||||||||
Cellular Location | Not Available | ||||||||||||||
Gene Properties | |||||||||||||||
Chromosome Location | 15 | ||||||||||||||
Locus | 15q21.1 | ||||||||||||||
SNPs | Not Available | ||||||||||||||
Gene Sequence | Not Available | ||||||||||||||
Protein Properties | |||||||||||||||
Number of Residues | Not Available | ||||||||||||||
Molecular Weight | 47482.24 | ||||||||||||||
Theoretical pI | 6.587 | ||||||||||||||
Pfam Domain Function | Not Available | ||||||||||||||
Signals | Not Available | ||||||||||||||
Transmembrane Regions | Not Available | ||||||||||||||
Protein Sequence |
>>gi|21359890|ref|NP_037441.2| zinc transporter 4 [Homo sapiens] MAGSGAWKRLKSMLRKDDAPLFLNDTSAFDFSDEAGDEGLSRFNKLRVVVADDGSEAPER PVNGAHPTLQ |
||||||||||||||
External Links | |||||||||||||||
GenBank ID Protein | Not Available | ||||||||||||||
UniProtKB/Swiss-Prot ID | O14863 | ||||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||||
PDB IDs | Not Available | ||||||||||||||
GenBank Gene ID | Not Available | ||||||||||||||
GeneCard ID | Not Available | ||||||||||||||
GenAtlas ID | Not Available | ||||||||||||||
HGNC ID | HGNC:11015 | ||||||||||||||
References | |||||||||||||||
General References | Not Available |