We are currently updating the database - data may be missing for the next 10 minutes. We apologize for any inconvenience.

Human Metabolome Database Version 2.5

 

Showing metabocard for Palmitoleic acid (HMDB03229)

Legend: metabolite field enzyme field

Version 2.5
Creation Date 2006-05-22 16:12:43
Update Date 2009-10-22 17:42:21
Accession Number HMDB03229
Secondary Accession Numbers Not Available
Common Name Palmitoleic acid
Description fatty acids, Monounsaturated Palmitoleic acid, or 9-hexadecenoic acid, is an unsaturated fatty acid that is a common constituent of the glycerides of human adipose tissue. Present in all tissues, generally found in higher concentrations in the liver. Macadamia oil (Macadamia integrifolia) and Sea Buckthorn oil (Hippophae rhamnoides) are botanical sources of palmitoleic acid, containing 22 and 40% respectively. -- Wikipedia
Synonyms
  1. (Z)-9-Hexadecenoate
  2. (Z)-9-Hexadecenoic acid
  3. (Z)-Hexadec-9-enoate
  4. (Z)-Hexadec-9-enoic acid
  5. 9-Hexadecenoate
  6. 9-Hexadecenoic acid
  7. 9-cis-Hexadecenoate
  8. 9-cis-Hexadecenoic acid
  9. Oleopalmitate
  10. Oleopalmitic acid
  11. Palmitoleate
  12. Palmitoleic acid
  13. Zoomerate
  14. Zoomeric acid
  15. cis-9-Hexadecenoate
  16. cis-9-Hexadecenoic acid
  17. cis-Palmitoleate
  18. cis-Palmitoleic acid
  19. cis-delta-9-Hexadecenoate
  20. cis-delta-9-Hexadecenoic acid
  21. Hexadecenoate
  22. Hexadecenoic acid
Chemical IUPAC Name (E)-hexadec-9-enoic acid
Chemical Formula C16H30O2
Chemical Structure Structure
Chemical Taxonomy
Kingdom
  • Organic
Super Class
  • Organic acids
Class
  • Fatty Acids
Sub Class
  • Long chain fatty acids
Family
  • Mammalian Metabolite
Species
  • carboxylic acid
  • alkene
Biofunction
Application
Source
  • Endogenous
Average Molecular Weight 254.408
Monoisotopic Molecular Weight 254.224579
Isomeric SMILES CCCCCCC=C/CCCCCCCC(O)=O
Canonical SMILES CCCCCCC=CCCCCCCCC(O)=O
KEGG Compound ID C08362 Link Image
BioCyc ID CPD-724 Link Image
BiGG ID 246167 Link Image
Wikipedia Link Palmitoleic acid Link Image
NuGOwiki Link HMDB03229 Link Image
Metagene Link HMDB03229 Link Image
METLIN ID 188 Link Image
PubChem Compound 5282745 Link Image
PubChem Substance 10520683 Link Image
ChEBI ID 28716 Link Image
CAS Registry Number 373-49-9
InChI Identifier InChI=1/C16H30O2/c1-2-3-4-5-6-7-8-9-10-11-12-13-14-15-16(17)18/h7-8H,2-6,9-15H2,1H3,(H,17,18)/b8-7-
Synthesis Reference Xu, Huashun; Luo, Yuping; Li, Siguang. Palmitoleic acid production by fermentation with yeast. Zhongguo Youzhi (1999), 24(6), 53-55.
Melting Point (Experimental) -0.1 oC
Experimental Water Solubility Not Available Source: PhysProp
Predicted Water Solubility 0.000429 mg/mL at 25 oC [MEYLAN,WM et al. (1996)]; 4.47e-04 mg/mL [Predicted by ALOGPS] Calculated using ALOGPS
Physiological Charge -1
State Liquid
Experimental LogP/Hydrophobicity Not Available Source: PhysProp
Predicted LogP/Hydrophobicity 6.71 [Predicted by ALOGPS]; 5.577 [Predicted by PubChem via XLOGP]; 6.75 [MEYLAN,WM & HOWARD,PH (1995)] Calculated using ALOGPS
Material Safety Data Sheet (MSDS)
MOL File Show
SDF File Show
PDB File Show
2D Structure
3D Structure
Experimental PDB ID Not Available
Experimental 1H NMR Spectrum Not Available
Experimental 13C NMR Spectrum Not Available
Experimental 13C HSQC Spectrum Not Available
Predicted 1H NMR Spectrum Show Image
Show Peaklist
Predicted 13C NMR Spectrum Show Image
Show Peaklist
Mass Spectrum Not Available
Simplified TOCSY Spectrum Not Available
BMRB Spectrum Not Available
Cellular Location
  • Membrane (Predicted from LogP)
Biofluid Location
  • Blood
  • Cerebrospinal Fluid
  • Urine
Tissue Location
Tissue References
Adipose Tissue
Skeletal Muscle
Concentrations (Normal)
Biofluid Blood
Value 31.0 (5.0-85.0) uM
Age Adult:>18 yrs old
Sex Both
Condition Normal
Comments Not Available
References
  • Hoffmann GF, Meier-Augenstein W, Stockler S, Surtees R, Rating D, Nyhan WL: Physiology and pathophysiology of organic acids in cerebrospinal fluid. J Inherit Metab Dis. 1993;16(4):648-69. [PubMed Link Image]
Biofluid Blood
Value 6.390 +/- 4.279 uM
Age Adult:>18 yrs old
Sex Both
Condition Normal
Comments Not Available
References
  • Wishart DS, Lewis MJ, Morrissey JA, Flegel MD, Jeroncic K, Xiong Y, Cheng D, Eisner R, Gautam B, Tzur D, Sawhney S, Bamforth F, Greiner R, Li L: The human cerebrospinal fluid metabolome. J Chromatogr B Analyt Technol Biomed Life Sci. 2008 Aug 15;871(2):164-173. Epub 2008 May 8. [PubMed Link Image]
  • Wishart DS, Knox C, Guo AC, Eisner R, Young N, Gautam B, Hau DD, Psychogios N, Dong E, Bouatra S, Mandal R, Sinelnikov I, Xia J, Jia L, Cruz JA, Lim E, Sobsey CA, Shrivastava S, Huang P, Liu P, Fang L, Peng J, Fradette R, Cheng D, Tzur D, Clements M, Lewis A, De Souza A, Zuniga A, Dawe M, Xiong Y, Clive D, Greiner R, Nazyrova A, Shaykhutdinov R, Li L, Vogel HJ, Forsythe I: HMDB: a knowledgebase for the human metabolome. Nucleic Acids Res. 2008 Oct 25. [PubMed Link Image]
Biofluid Blood
Value 4.5 +/- 2.8 uM
Age Adult:>18 yrs old
Sex Both
Condition Adults
Comments Not Available
References
  • Geigy Scientific Tables, 8th Rev edition, pp. 165-177. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp., Basel, Switzerland c1981-1992.
Biofluid CSF
Value 2.0 +/- 2.0 uM
Age Adult:>18 yrs old
Sex Both
Condition Normal
Comments Not Available
References
  • Hoffmann GF, Meier-Augenstein W, Stockler S, Surtees R, Rating D, Nyhan WL: Physiology and pathophysiology of organic acids in cerebrospinal fluid. J Inherit Metab Dis. 1993;16(4):648-69. [PubMed Link Image]
Biofluid Urine
Value 0.03 +/- 0.02 umol/mmol creatinine
Age Adult:>18 yrs old
Sex Both
Condition Normal
Comments Not Available
References
  • Geigy Scientific Tables, 8th Rev edition, pp. 130. Edited by C. Lentner, West Cadwell, N.J.: Medical education Div., Ciba-Geigy Corp. Basel, Switzerland c1981-1992.
Concentrations (Abnormal) Not Available
Associated Disorders Not Available
OMIM ID Not Available
Pathways Not Available
General References
  1. Katsuta Y, Iida T, Inomata S, Denda M: Unsaturated fatty acids induce calcium influx into keratinocytes and cause abnormal differentiation of epidermis. J Invest Dermatol. 2005 May;124(5):1008-13. [PubMed Link Image]
  2. Rossner S, Walldius G, Bjorvell H: Fatty acid composition in serum lipids and adipose tissue in severe obesity before and after six weeks of weight loss. Int J Obes. 1989;13(5):603-12. [PubMed Link Image]
  3. Ho RC, Davy KP, Hickey MS, Summers SA, Melby CL: Behavioral, metabolic, and molecular correlates of lower insulin sensitivity in Mexican-Americans. Am J Physiol Endocrinol Metab. 2002 Oct;283(4):E799-808. [PubMed Link Image]
  4. Hori Y, Nakamura K, Yamamoto M, Shimada K, Nakadaira H, Shibuya N, Endoh K, Ogoshi K: Determination of free fatty acids in human bile by high-performance liquid chromatography. Ann Clin Biochem. 1998 Mar;35 ( Pt 2):279-82. [PubMed Link Image]
  5. Yli-Jama P, Haugen TS, Rebnord HM, Ringstad J, Pedersen JI: Selective mobilisation of fatty acids from human adipose tissue. Eur J Intern Med. 2001 Apr;12(2):107-115. [PubMed Link Image]
  6. Prandota J: Clinical pharmacology of antibiotics and other drugs in cystic fibrosis. Drugs. 1988 May;35(5):542-78. [PubMed Link Image]
  7. Wikipedia Link Image
Metabolic Enzymes
  1. Thioesterase domain containing 1
Enzyme 1 [top]
Enzyme 1 ID 8493
Enzyme 1 Name Thioesterase domain containing 1
Enzyme 1 Synonyms Not Available
Enzyme 1 Gene Name THEDC1
Enzyme 1 Protein Sequence >Thioesterase domain containing 1
MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRL
PGRESRVEEPLENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQP
EPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPII
RADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYL
LDPANEKLIKNYIIKCLEVSSISNF
Enzyme 1 Number of Residues 265
Enzyme 1 Molecular Weight 29931
Enzyme 1 Theoretical pI 6.17
Enzyme 1 GO Classification
Function
  • CoA hydrolase activity
  • acyl-CoA thioesterase II activity
  • acyl-CoA thioesterase activity
  • catalytic activity
  • hydrolase activity
  • hydrolase activity, acting on ester bonds
  • thiolester hydrolase activity
Process
  • biosynthesis
  • metabolism
  • physiological process
Component
Enzyme 1 General Function Secondary metabolites biosynthesis, transport and catabolism
Enzyme 1 Specific Function Not Available
Enzyme 1 Pathways Not Available
Enzyme 1 Reactions Not Available
Enzyme 1 Pfam Domain Function
Enzyme 1 Signals Not Available
Enzyme 1 Transmembrane Regions Not Available
Enzyme 1 Essentiality Not Available
Enzyme 1 GenBank ID Protein Not Available
Enzyme 1 UniProtKB/Swiss-Prot ID Q5VUB6 Link Image
Enzyme 1 UniProtKB/Swiss-Prot Entry Name Q5VUB6_HUMAN Link Image
Enzyme 1 PDB ID Not Available
Enzyme 1 Cellular Location Not Available
Enzyme 1 Gene Sequence Not Available
Enzyme 1 GenBank Gene ID AL590365 Link Image
Enzyme 1 GeneCard ID OLAH Link Image
Enzyme 1 GenAtlas ID OLAH Link Image
Enzyme 1 HGNC ID HGNC:25625 Link Image
Enzyme 1 Chromosome Location 10
Enzyme 1 Locus 10p13
Enzyme 1 SNPs SNPJam Report Link Image
Enzyme 1 General References Not Available
Enzyme 1 Metabolite References Not Available