Hmdb loader
Identification
HMDB Protein ID HMDBP02216
Secondary Accession Numbers
  • 7701
Name C-terminal-binding protein 1
Synonyms
  1. CtBP1
Gene Name CTBP1
Protein Type Unknown
Biological Properties
General Function Involved in oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Specific Function Involved in controlling the equilibrium between tubular and stacked structures in the Golgi complex. Functions in brown adipose tissue (BAT) differentiation. Corepressor targeting diverse transcription regulators such as GLIS2. Has dehydrogenase activity
Pathways Not Available
Reactions Not Available
GO Classification
Function
binding
nucleotide binding
catalytic activity
nad or nadh binding
oxidoreductase activity, acting on the ch-oh group of donors, nad or nadp as acceptor
cofactor binding
oxidoreductase activity, acting on ch-oh group of donors
oxidoreductase activity
Process
metabolic process
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location Chromosome:4
Locus 4p16
SNPs CTBP1
Gene Sequence
>1323 bp
ATGGGCAGCTCGCACTTGCTCAACAAGGGCCTGCCGCTTGGCGTCCGACCTCCGATCATG
AACGGGCCCCTGCACCCGCGGCCCCTGGTGGCATTGCTGGATGGCCGGGACTGCACAGTG
GAGATGCCCATCCTGAAGGACGTGGCCACTGTGGCCTTCTGCGACGCGCAGTCCACGCAG
GAGATCCATGAGAAGGTCCTGAACGAGGCTGTGGGGGCCCTGATGTACCACACCATCACT
CTCACCAGGGAGGACCTGGAGAAGTTCAAAGCCCTCCGCATCATCGTCCGGATTGGCAGT
GGTTTTGACAACATCGACATCAAGTCGGCCGGGGATTTAGGCATTGCCGTCTGCAACGTG
CCCGCGGCGTCTGTGGAGGAGACGGCCGACTCGACGCTGTGCCACATCCTGAACCTGTAC
CGGCGGGCCACCTGGCTGCACCAGGCGCTGCGGGAGGGCACACGAGTCCAGAGCGTCGAG
CAGATCCGCGAGGTGGCGTCCGGCGCTGCCAGGATCCGCGGGGAGACCTTGGGCATCATC
GGACTTGGTCGCGTGGGGCAGGCAGTGGCGCTGCGGGCCAAGGCCTTCGGCTTCAACGTG
CTCTTCTACGACCCTTACTTGTCGGATGGCGTGGAGCGGGCGCTGGGGCTGCAGCGTGTC
AGCACCCTGCAGGACCTGCTCTTCCACAGCGACTGCGTGACCCTGCACTGCGGCCTCAAC
GAGCACAACCACCACCTCATCAACGACTTCACCGTCAAGCAGATGAGACAAGGGGCCTTC
CTGGTGAACACAGCCCGGGGTGGCCTGGTGGATGAGAAGGCGCTGGCCCAGGCCCTGAAG
GAGGGCCGGATCCGCGGCGCGGCCCTGGATGTGCACGAGTCGGAACCCTTCAGCTTTAGC
CAGGGCCCTCTGAAGGATGCACCCAACCTCATCTGCACCCCCCATGCTGCATGGTACAGC
GAGCAGGCATCCATCGAGATGCGAGAGGAGGCGGCACGGGAGATCCGCAGAGCCATCACA
GGCCGGATCCCAGACAGCCTGAAGAACTGTGTCAACAAGGACCATCTGACAGCCGCCACC
CACTGGGCCAGCATGGACCCCGCCGTCGTGCACCCTGAGCTCAATGGGGCTGCCTATAGG
TACCCTCCGGGCGTGGTGGGCGTGGCCCCCACTGGCATCCCAGCTGCTGTGGAAGGTATC
GTCCCCAGCGCCATGTCCCTGTCCCACGGCCTGCCCCCTGTGGCCCACCCGCCCCACGCC
CCTTCTCCTGGCCAAACCGTCAAGCCCGAGGCGGATAGAGACCACGCCAGTGACCAGTTG
TAG
Protein Properties
Number of Residues 440
Molecular Weight 47534.9
Theoretical pI 6.76
Pfam Domain Function
Signals
  • None
Transmembrane Regions
  • None
Protein Sequence
>C-terminal-binding protein 1
MGSSHLLNKGLPLGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQ
EIHEKVLNEAVGALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNV
PAASVEETADSTLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGII
GLGRVGQAVALRAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLN
EHNHHLINDFTVKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFS
QGPLKDAPNLICTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAAT
HWASMDPAVVHPELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHA
PSPGQTVKPEADRDHASDQL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q13363
UniProtKB/Swiss-Prot Entry Name CTBP1_HUMAN
PDB IDs
GenBank Gene ID U37408
GeneCard ID CTBP1
GenAtlas ID CTBP1
HGNC ID HGNC:2494
References
General References
  1. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [PubMed:15815621 ]
  2. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  3. Chakraborty S, Senyuk V, Sitailo S, Chi Y, Nucifora G: Interaction of EVI1 with cAMP-responsive element-binding protein-binding protein (CBP) and p300/CBP-associated factor (P/CAF) results in reversible acetylation of EVI1 and in co-localization in nuclear speckles. J Biol Chem. 2001 Nov 30;276(48):44936-43. Epub 2001 Sep 21. [PubMed:11568182 ]
  4. Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ: ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage. Science. 2007 May 25;316(5828):1160-6. [PubMed:17525332 ]
  5. Ueda J, Tachibana M, Ikura T, Shinkai Y: Zinc finger protein Wiz links G9a/GLP histone methyltransferases to the co-repressor molecule CtBP. J Biol Chem. 2006 Jul 21;281(29):20120-8. Epub 2006 May 15. [PubMed:16702210 ]
  6. Schaeper U, Boyd JM, Verma S, Uhlmann E, Subramanian T, Chinnadurai G: Molecular cloning and characterization of a cellular phosphoprotein that interacts with a conserved C-terminal domain of adenovirus E1A involved in negative modulation of oncogenic transformation. Proc Natl Acad Sci U S A. 1995 Nov 7;92(23):10467-71. [PubMed:7479821 ]
  7. Sewalt RG, Gunster MJ, van der Vlag J, Satijn DP, Otte AP: C-Terminal binding protein is a transcriptional repressor that interacts with a specific class of vertebrate Polycomb proteins. Mol Cell Biol. 1999 Jan;19(1):777-87. [PubMed:9858600 ]
  8. Boyd JM, Subramanian T, Schaeper U, La Regina M, Bayley S, Chinnadurai G: A region in the C-terminus of adenovirus 2/5 E1a protein is required for association with a cellular phosphoprotein and important for the negative modulation of T24-ras mediated transformation, tumorigenesis and metastasis. EMBO J. 1993 Feb;12(2):469-78. [PubMed:8440238 ]
  9. Touitou R, Hickabottom M, Parker G, Crook T, Allday MJ: Physical and functional interactions between the corepressor CtBP and the Epstein-Barr virus nuclear antigen EBNA3C. J Virol. 2001 Aug;75(16):7749-55. [PubMed:11462050 ]
  10. Vo N, Fjeld C, Goodman RH: Acetylation of nuclear hormone receptor-interacting protein RIP140 regulates binding of the transcriptional corepressor CtBP. Mol Cell Biol. 2001 Sep;21(18):6181-8. [PubMed:11509661 ]
  11. Hickabottom M, Parker GA, Freemont P, Crook T, Allday MJ: Two nonconsensus sites in the Epstein-Barr virus oncoprotein EBNA3A cooperate to bind the co-repressor carboxyl-terminal-binding protein (CtBP). J Biol Chem. 2002 Dec 6;277(49):47197-204. Epub 2002 Oct 7. [PubMed:12372828 ]
  12. Kagey MH, Melhuish TA, Wotton D: The polycomb protein Pc2 is a SUMO E3. Cell. 2003 Apr 4;113(1):127-37. [PubMed:12679040 ]
  13. Zhang Q, Yoshimatsu Y, Hildebrand J, Frisch SM, Goodman RH: Homeodomain interacting protein kinase 2 promotes apoptosis by downregulating the transcriptional corepressor CtBP. Cell. 2003 Oct 17;115(2):177-86. [PubMed:14567915 ]
  14. Alpatov R, Munguba GC, Caton P, Joo JH, Shi Y, Shi Y, Hunt ME, Sugrue SP: Nuclear speckle-associated protein Pnn/DRS binds to the transcriptional corepressor CtBP and relieves CtBP-mediated repression of the E-cadherin gene. Mol Cell Biol. 2004 Dec;24(23):10223-35. [PubMed:15542832 ]
  15. Castet A, Boulahtouf A, Versini G, Bonnet S, Augereau P, Vignon F, Khochbin S, Jalaguier S, Cavailles V: Multiple domains of the Receptor-Interacting Protein 140 contribute to transcription inhibition. Nucleic Acids Res. 2004 Apr 1;32(6):1957-66. Print 2004. [PubMed:15060175 ]
  16. Long J, Zuo D, Park M: Pc2-mediated sumoylation of Smad-interacting protein 1 attenuates transcriptional repression of E-cadherin. J Biol Chem. 2005 Oct 21;280(42):35477-89. Epub 2005 Aug 1. [PubMed:16061479 ]
  17. Nitta E, Izutsu K, Yamaguchi Y, Imai Y, Ogawa S, Chiba S, Kurokawa M, Hirai H: Oligomerization of Evi-1 regulated by the PR domain contributes to recruitment of corepressor CtBP. Oncogene. 2005 Sep 8;24(40):6165-73. [PubMed:15897867 ]
  18. Schon C, Wochnik A, Rossner A, Donow C, Knochel W: The FoxP subclass in Xenopus laevis development. Dev Genes Evol. 2006 Oct;216(10):641-6. Epub 2006 Apr 12. [PubMed:16609867 ]
  19. Purbey PK, Singh S, Notani D, Kumar PP, Limaye AS, Galande S: Acetylation-dependent interaction of SATB1 and CtBP1 mediates transcriptional repression by SATB1. Mol Cell Biol. 2009 Mar;29(5):1321-37. doi: 10.1128/MCB.00822-08. Epub 2008 Dec 22. [PubMed:19103759 ]
  20. Kumar V, Carlson JE, Ohgi KA, Edwards TA, Rose DW, Escalante CR, Rosenfeld MG, Aggarwal AK: Transcription corepressor CtBP is an NAD(+)-regulated dehydrogenase. Mol Cell. 2002 Oct;10(4):857-69. [PubMed:12419229 ]