Hmdb loader
Identification
HMDB Protein ID HMDBP08720
Secondary Accession Numbers
  • 14443
Name Eyes absent homolog 1
Synonyms Not Available
Gene Name EYA1
Protein Type Unknown
Biological Properties
General Function Involved in catalytic activity
Specific Function Tyrosine phosphatase that specifically dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Promotes efficient DNA repair by dephosphorylating H2AX, promoting the recruitment of DNA repair complexes containing MDC1. Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis. Seems to coactivate SIX2, SIX4 and SIX5. May be required for normal development of branchial arches, ear and kidney.
Pathways
  • Transcriptional misregulation in cancer
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Biological Process
sensory perception of sound
negative regulation of apoptotic process
pattern specification process
response to ionizing radiation
double-strand break repair
anatomical structure morphogenesis
semicircular canal morphogenesis
positive regulation of transcription from RNA polymerase II promoter
aorta morphogenesis
branching involved in ureteric bud morphogenesis
cell fate commitment
cellular protein localization
cochlea morphogenesis
embryonic skeletal system morphogenesis
establishment of mitotic spindle orientation
establishment or maintenance of apical/basal cell polarity
histone dephosphorylation
lung epithelial cell differentiation
metanephros development
middle ear morphogenesis
otic vesicle morphogenesis
outer ear morphogenesis
outflow tract morphogenesis
pharyngeal system development
positive regulation of DNA repair
positive regulation of Notch signaling pathway
positive regulation of secondary heart field cardioblast proliferation
protein sumoylation
regulation of neuron differentiation
striated muscle tissue development
positive regulation of epithelial cell proliferation
transcription, DNA-dependent
Cellular Component
cytoplasm
nucleus
Function
catalytic activity
Molecular Function
metal ion binding
protein tyrosine phosphatase activity
Process
metabolic process
multicellular organismal process
multicellular organismal development
Cellular Location
  1. Nucleus
  2. Cytoplasm
Gene Properties
Chromosome Location 8
Locus 8q13.3
SNPs EYA1
Gene Sequence
>1779 bp
ATGGAAATGCAGGATCTAACCAGCCCGCATAGCCGTCTGAGTGGTAGTAGTGAATCCCCC
AGTGGCCCCAAACTCGGTAACTCTCATATAAATAGTAATTCCATGACTCCCAATGGCACC
GAAGTTAAAACAGAGCCAATGAGCAGCAGTGAAACAGCTTCAACGACAGCCGACGGGTCT
TTAAACAATTTCTCAGGTTCAGCAATTGGGAGCAGTAGTTTCAGCCCACGACCAACTCAC
CAGTTCTCTCCACCACAGATTTACCCTTCCAACAGACCATACCCACATATTCTCCCTACC
CCTTCCTCACAAACTATGGCTGCATATGGGCAAACACAGTTTACCACAGGAATGCAACAA
GCTACAGCCTATGCCACGTACCCACAGCCAGGACAGCCGTACGGCATTTCCTCATATGGT
GCATTGTGGGCAGGCATCAAGACTGAAGGTGGATTGTCACAGTCTCAGTCACCTGGACAG
ACAGGATTTCTCAGCTATGGCACAAGCTTCAGTACCCCTCAACCTGGACAGGCACCATAC
AGCTACCAGATGCAAGGTAGCAGTTTTACAACATCATCAGGAATATATACAGGAAATAAT
TCACTCACAAATTCCTCTGGATTTAATAGTTCACAGCAGGACTATCCGTCTTATCCCAGT
TTTGGCCAGGGTCAGTACGCACAGTATTATAACAGCTCACCGTATCCAGCACATTATATG
ACCAGCAGCAACACCAGCCCAACGACACCATCCACCAATGCCACTTACCAGCTTCAAGAA
CCGCCATCTGGCATCACCAGCCAAGCAGTTACAGATCCCACAGCAGAGTACAGCACAATC
CACAGCCCATCAACACCCATTAAAGATTCAGATTCTGATCGATTGCGTCGAGGTTCAGAT
GGGAAATCACGTGGACGGGGCCGAAGAAACAATAATCCTTCACCTCCCCCAGATTCTGAT
CTTGAGAGAGTGTTCATCTGGGACTTGGATGAGACAATCATTGTTTTCCACTCCTTGCTT
ACTGGGTCCTACGCCAACAGATATGGGAGGGATCCACCCACTTCAGTTTCCCTTGGACTG
CGAATGGAAGAAATGATTTTCAACTTGGCAGACACACATTTATTTTTTAATGACTTAGAA
GAATGTGACCAAGTCCATATAGATGATGTTTCTTCAGATGATAACGGACAGGACCTAAGC
ACATATAACTTTGGAACAGATGGCTTTCCTGCTGCAGCAACCAGTGCTAACTTATGTTTG
GCAACTGGTGTACGGGGCGGTGTGGACTGGATGAGAAAGTTGGCCTTCCGCTACAGACGG
GTAAAAGAGATCTACAACACCTACAAAAATAATGTTGGAGGTCTGCTTGGTCCAGCTAAG
AGGGAAGCCTGGCTGCAGTTGAGGGCCGAAATTGAAGCCCTGACCGACTCCTGGTTGACA
CTGGCCCTGAAAGCACTCTCGCTCATTCACTCCCGGACAAACTGTGTGAATATTTTAGTA
ACAACTACTCAGCTCATCCCAGCATTGGCGAAAGTCCTGCTGTATGGGTTAGGAATTGTA
TTTCCAATAGAAAATATTTACAGTGCAACTAAAATAGGAAAAGAAAGCTGTTTTGAGAGA
ATAATTCAAAGGTTTGGAAGAAAAGTGGTGTATGTTGTTATAGGAGATGGTGTAGAAGAA
GAACAAGGAGCAAAAAAGCACGCGATGCCCTTCTGGAGGATCTCCAGCCACTCGGACCTC
ATGGCCCTGCACCATGCCTTGGAACTGGAGTACCTGTAA
Protein Properties
Number of Residues 592
Molecular Weight 64592.905
Theoretical pI 6.21
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>Eyes absent homolog 1
MEMQDLTSPHSRLSGSSESPSGPKLGNSHINSNSMTPNGTEVKTEPMSSSETASTTADGS
LNNFSGSAIGSSSFSPRPTHQFSPPQIYPSNRPYPHILPTPSSQTMAAYGQTQFTTGMQQ
ATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSFSTPQPGQAPY
SYQMQGSSFTTSSGIYTGNNSLTNSSGFNSSQQDYPSYPSFGQGQYAQYYNSSPYPAHYM
TSSNTSPTTPSTNATYQLQEPPSGITSQAVTDPTAEYSTIHSPSTPIKDSDSDRLRRGSD
GKSRGRGRRNNNPSPPPDSDLERVFIWDLDETIIVFHSLLTGSYANRYGRDPPTSVSLGL
RMEEMIFNLADTHLFFNDLEECDQVHIDDVSSDDNGQDLSTYNFGTDGFPAAATSANLCL
ATGVRGGVDWMRKLAFRYRRVKEIYNTYKNNVGGLLGPAKREAWLQLRAEIEALTDSWLT
LALKALSLIHSRTNCVNILVTTTQLIPALAKVLLYGLGIVFPIENIYSATKIGKESCFER
IIQRFGRKVVYVVIGDGVEEEQGAKKHAMPFWRISSHSDLMALHHALELEYL
GenBank ID Protein 19923100
UniProtKB/Swiss-Prot ID Q99502
UniProtKB/Swiss-Prot Entry Name EYA1_HUMAN
PDB IDs Not Available
GenBank Gene ID NM_000503.4
GeneCard ID EYA1
GenAtlas ID EYA1
HGNC ID HGNC:3519
References
General References
  1. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334 ]
  2. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [PubMed:16421571 ]
  3. Cook PJ, Ju BG, Telese F, Wang X, Glass CK, Rosenfeld MG: Tyrosine dephosphorylation of H2AX modulates apoptosis and survival decisions. Nature. 2009 Apr 2;458(7238):591-6. doi: 10.1038/nature07849. Epub 2009 Feb 22. [PubMed:19234442 ]
  4. Abdelhak S, Kalatzis V, Heilig R, Compain S, Samson D, Vincent C, Levi-Acobas F, Cruaud C, Le Merrer M, Mathieu M, Konig R, Vigneron J, Weissenbach J, Petit C, Weil D: Clustering of mutations responsible for branchio-oto-renal (BOR) syndrome in the eyes absent homologous region (eyaHR) of EYA1. Hum Mol Genet. 1997 Dec;6(13):2247-55. [PubMed:9361030 ]
  5. Abdelhak S, Kalatzis V, Heilig R, Compain S, Samson D, Vincent C, Weil D, Cruaud C, Sahly I, Leibovici M, Bitner-Glindzicz M, Francis M, Lacombe D, Vigneron J, Charachon R, Boven K, Bedbeder P, Van Regemorter N, Weissenbach J, Petit C: A human homologue of the Drosophila eyes absent gene underlies branchio-oto-renal (BOR) syndrome and identifies a novel gene family. Nat Genet. 1997 Feb;15(2):157-64. [PubMed:9020840 ]
  6. Fougerousse F, Durand M, Lopez S, Suel L, Demignon J, Thornton C, Ozaki H, Kawakami K, Barbet P, Beckmann JS, Maire P: Six and Eya expression during human somitogenesis and MyoD gene family activation. J Muscle Res Cell Motil. 2002;23(3):255-64. [PubMed:12500905 ]
  7. Vincent C, Kalatzis V, Abdelhak S, Chaib H, Compain S, Helias J, Vaneecloo FM, Petit C: BOR and BO syndromes are allelic defects of EYA1. Eur J Hum Genet. 1997 Jul-Aug;5(4):242-6. [PubMed:9359046 ]
  8. Kumar S, Deffenbacher K, Cremers CW, Van Camp G, Kimberling WJ: Branchio-oto-renal syndrome: identification of novel mutations, molecular characterization, mutation distribution, and prospects for genetic testing. Genet Test. 1997-1998;1(4):243-51. [PubMed:10464653 ]
  9. Azuma N, Hirakiyama A, Inoue T, Asaka A, Yamada M: Mutations of a human homologue of the Drosophila eyes absent gene (EYA1) detected in patients with congenital cataracts and ocular anterior segment anomalies. Hum Mol Genet. 2000 Feb 12;9(3):363-6. [PubMed:10655545 ]
  10. Rickard S, Boxer M, Trompeter R, Bitner-Glindzicz M: Importance of clinical evaluation and molecular testing in the branchio-oto-renal (BOR) syndrome and overlapping phenotypes. J Med Genet. 2000 Aug;37(8):623-7. [PubMed:10991693 ]
  11. Rickard S, Parker M, van't Hoff W, Barnicoat A, Russell-Eggitt I, Winter RM, Bitner-Glindzicz M: Oto-facio-cervical (OFC) syndrome is a contiguous gene deletion syndrome involving EYA1: molecular analysis confirms allelism with BOR syndrome and further narrows the Duane syndrome critical region to 1 cM. Hum Genet. 2001 May;108(5):398-403. [PubMed:11409867 ]
  12. Namba A, Abe S, Shinkawa H, Kimberling WJ, Usami SI: Genetic features of hearing loss associated with ear anomalies: PDS and EYA1 mutation analysis. J Hum Genet. 2001;46(9):518-21. [PubMed:11558900 ]
  13. Yashima T, Noguchi Y, Ishikawa K, Mizusawa H, Kitamura K: Mutation of the EYA1 gene in patients with branchio-oto syndrome. Acta Otolaryngol. 2003 Jan;123(2):279-82. [PubMed:12701758 ]
  14. Estefania E, Ramirez-Camacho R, Gomar M, Trinidad A, Arellano B, Garcia-Berrocal JR, Verdaguer JM, Vilches C: Point mutation of an EYA1-gene splice site in a patient with oto-facio-cervical syndrome. Ann Hum Genet. 2006 Jan;70(Pt 1):140-4. [PubMed:16441263 ]
  15. Spruijt L, Hoefsloot LH, van Schaijk GH, van Waardenburg D, Kremer B, Brackel HJ, de Die-Smulders CE: Identification of a novel EYA1 mutation presenting in a newborn with laryngomalacia, glossoptosis, retrognathia, and pectus excavatum. Am J Med Genet A. 2006 Jun 15;140(12):1343-5. [PubMed:16691597 ]