| Identification |
| HMDB Protein ID
| HMDBP10819 |
| Secondary Accession Numbers
| |
| Name
| Gamma-aminobutyric acid receptor-associated protein |
| Synonyms
|
- GABA(A) receptor-associated protein
- MM46
|
| Gene Name
| GABARAP |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Involved in beta-tubulin binding |
| Specific Function
| May play a role in intracellular transport of GABA(A) receptors and its interaction with the cytoskeleton |
| Pathways
|
Not Available
|
| Reactions
| Not Available |
| GO Classification
|
Not Available
|
| Cellular Location
|
- Cytoplasm
- Endomembrane system
- Golgi apparatus membrane
- cytoskeleton
|
| Gene Properties |
| Chromosome Location
| Chromosome:1 |
| Locus
| 17p13.1 |
| SNPs
| GABARAP |
| Gene Sequence
|
>354 bp
ATGAAGTTCGTGTACAAAGAAGAGCATCCGTTCGAGAAGCGCCGCTCTGAGGGCGAGAAG
ATCCGAAAGAAATACCCGGACCGGGTGCCGGTGATAGTAGAAAAGGCTCCCAAAGCTCGG
ATAGGAGACCTGGACAAAAAGAAATACCTGGTGCCTTCTGATCTCACAGTTGGTCAGTTC
TACTTCTTGATCCGGAAGCGAATTCATCTCCGAGCTGAAGATGCCTTGTTTTTCTTTGTC
AACAATGTCATTCCACCCACCAGTGCCACAATGGGTCAGCTGTACCAGGAACACCATGAA
GAAGACTTCTTTCTCTACATTGCCTACAGTGACGAAAGTGTCTACGGTCTGTGA
|
| Protein Properties |
| Number of Residues
| 117 |
| Molecular Weight
| 13917.9 |
| Theoretical pI
| 9.21 |
| Pfam Domain Function
|
|
| Signals
|
|
|
Transmembrane Regions
|
|
| Protein Sequence
|
>Gamma-aminobutyric acid receptor-associated protein
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQF
YFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYGL
|
| External Links |
| GenBank ID Protein
| 12641851 |
| UniProtKB/Swiss-Prot ID
| O95166 |
| UniProtKB/Swiss-Prot Entry Name
| GBRAP_HUMAN |
| PDB IDs
|
|
| GenBank Gene ID
| AB030711 |
| GeneCard ID
| GABARAP |
| GenAtlas ID
| GABARAP |
| HGNC ID
| HGNC:4067 |
| References |
| General References
| - Hu RM, Han ZG, Song HD, Peng YD, Huang QH, Ren SX, Gu YJ, Huang CH, Li YB, Jiang CL, Fu G, Zhang QH, Gu BW, Dai M, Mao YF, Gao GF, Rong R, Ye M, Zhou J, Xu SH, Gu J, Shi JX, Jin WR, Zhang CK, Wu TM, Huang GY, Chen Z, Chen MD, Chen JL: Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning. Proc Natl Acad Sci U S A. 2000 Aug 15;97(17):9543-8. [PubMed:10931946 ]
- Okazaki N, Yan J, Yuasa S, Ueno T, Kominami E, Masuho Y, Koga H, Muramatsu M: Interaction of the Unc-51-like kinase and microtubule-associated protein light chain 3 related proteins in the brain: possible role of vesicular transport in axonal elongation. Brain Res Mol Brain Res. 2000 Dec 28;85(1-2):1-12. [PubMed:11146101 ]
- Wang H, Bedford FK, Brandon NJ, Moss SJ, Olsen RW: GABA(A)-receptor-associated protein links GABA(A) receptors and the cytoskeleton. Nature. 1999 Jan 7;397(6714):69-72. [PubMed:9892355 ]
- Knight D, Harris R, McAlister MS, Phelan JP, Geddes S, Moss SJ, Driscoll PC, Keep NH: The X-ray crystal structure and putative ligand-derived peptide binding properties of gamma-aminobutyric acid receptor type A receptor-associated protein. J Biol Chem. 2002 Feb 15;277(7):5556-61. Epub 2001 Nov 29. [PubMed:11729197 ]
- Stangler T, Mayr LM, Willbold D: Solution structure of human GABA(A) receptor-associated protein GABARAP: implications for biolgoical funcrion and its regulation. J Biol Chem. 2002 Apr 19;277(16):13363-6. Epub 2002 Mar 1. [PubMed:11875056 ]
- Kouno T, Miura K, Kanematsu T, Shirakawa M, Hirata M, Kawano K: 1H, 13C and '5N resonance assignments of GABARAP, GABAA receptor associated protein. J Biomol NMR. 2002 Jan;22(1):97-8. [PubMed:11885988 ]
|