| Identification |
| HMDB Protein ID
| HMDBP11602 |
| Secondary Accession Numbers
| None |
| Name
| Acyl-CoA synthetase short-chain family member 3, mitochondrial |
| Synonyms
|
- Acyl-CoA synthetase short-chain family member 3
|
| Gene Name
| ACSS3 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Activates acetate so that it can be used for lipid synthesis or for energy generation (By similarity).
|
| Pathways
|
- Malonic Aciduria
- Malonyl-coa decarboxylase deficiency
- Methylmalonic Aciduria Due to Cobalamin-Related Disorders
- Mitochondrial Beta-Oxidation of Short Chain Saturated Fatty Acids
- Propanoate metabolism
- Propanoate metabolism
- Short-chain 3-hydroxyacyl-CoA dehydrogenase deficiency (SCHAD)
|
| Reactions
|
| Adenosine triphosphate + Acetic acid + Coenzyme A → Adenosine monophosphate + Pyrophosphate + Acetyl-CoA |
details
|
| Propinol adenylate + Coenzyme A → Adenosine monophosphate + Propionyl-CoA |
details
|
| Adenosine triphosphate + Propionic acid → Pyrophosphate + Propinol adenylate |
details
|
|
| GO Classification
|
| Cellular Component |
| mitochondrion |
| Molecular Function |
| ATP binding |
| acetate-CoA ligase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 12 |
| Locus
| 12q21.31 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 74777.655 |
| Theoretical pI
| 8.638 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|13375727|ref|NP_078836.1| acyl-CoA synthetase short-chain family member 3, mitochondrial precursor [Homo sapiens]
MKPSWLQCRKVTSAGGLGGPLPGSSPARGAGAALRALVVPGPRGGLGGRGCRALSSGSGS
EYKTHFAASV
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9H6R3 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:24723 |
| References |
| General References
| Not Available |