Showing Protein Activation-induced cytidine deaminase (HMDBP11605)
Identification | ||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11605 | |||||||||||||||
Secondary Accession Numbers | None | |||||||||||||||
Name | Activation-induced cytidine deaminase | |||||||||||||||
Synonyms |
|
|||||||||||||||
Gene Name | AICDA | |||||||||||||||
Protein Type | Unknown | |||||||||||||||
Biological Properties | ||||||||||||||||
General Function | Not Available | |||||||||||||||
Specific Function | Single-stranded DNA-specific cytidine deaminase. Involved in somatic hypermutation, gene conversion, and class-switch recombination in B-lymphocytes. Required for several crucial steps of B-cell terminal differentiation necessary for efficient antibody responses. May also play a role in the epigenetic regulation of gene expression by participating in DNA demethylation. | |||||||||||||||
Pathways |
|
|||||||||||||||
Reactions |
|
|||||||||||||||
GO Classification |
|
|||||||||||||||
Cellular Location | Not Available | |||||||||||||||
Gene Properties | ||||||||||||||||
Chromosome Location | 12 | |||||||||||||||
Locus | 12p13 | |||||||||||||||
SNPs | Not Available | |||||||||||||||
Gene Sequence | Not Available | |||||||||||||||
Protein Properties | ||||||||||||||||
Number of Residues | Not Available | |||||||||||||||
Molecular Weight | 23953.265 | |||||||||||||||
Theoretical pI | 9.394 | |||||||||||||||
Pfam Domain Function | Not Available | |||||||||||||||
Signals | Not Available | |||||||||||||||
Transmembrane Regions | Not Available | |||||||||||||||
Protein Sequence |
>>gi|10190700|ref|NP_065712.1| activation-induced cytidine deaminase [Homo sapiens] MDSLLMNRRKFLYQFKNVRWAKGRRETYLCYVVKRRDSATSFSLDFGYLRNKNGCHVELL FLRYISDWDL |
|||||||||||||||
External Links | ||||||||||||||||
GenBank ID Protein | Not Available | |||||||||||||||
UniProtKB/Swiss-Prot ID | Q9GZX7 | |||||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||||||
PDB IDs | Not Available | |||||||||||||||
GenBank Gene ID | Not Available | |||||||||||||||
GeneCard ID | Not Available | |||||||||||||||
GenAtlas ID | Not Available | |||||||||||||||
HGNC ID | HGNC:13203 | |||||||||||||||
References | ||||||||||||||||
General References | Not Available |