Hmdb loader
Identification
HMDB Protein ID HMDBP11727
Secondary Accession Numbers None
Name Elongation of very long chain fatty acids protein 3
Synonyms
  1. 3-keto acyl-CoA synthase ELOVL3
  2. Cold-inducible glycoprotein of 30 kDa
  3. ELOVL fatty acid elongase 3
  4. Very-long-chain 3-oxoacyl-CoA synthase 3
  5. ELOVL FA elongase 3
Gene Name ELOVL3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Condensing enzyme that elongates saturated and monounsaturated very long chain fatty acids (VLCFAs). Highest activity toward C18 acyl-CoAs, especially C18:0 acyl-CoAs.
Pathways
  • Fatty acid elongation
Reactions
A very-long-chain acyl-CoA + Malonyl-CoA → Coenzyme A + a very-long-chain 3-oxoacyl-CoA + CO(2) details
Malonyl-CoA + Acyl-CoA → 3-Oxoacyl-CoA + Coenzyme A + Carbon dioxide details
GO Classification
Biological Process
long-chain fatty-acyl-CoA biosynthetic process
triglyceride biosynthetic process
fatty acid elongation, monounsaturated fatty acid
fatty acid elongation, saturated fatty acid
very long-chain fatty acid biosynthetic process
fatty acid elongation, polyunsaturated fatty acid
Cellular Component
integral to membrane
endoplasmic reticulum membrane
Molecular Function
transferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 10
Locus 10q24.32
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 31500.285
Theoretical pI 9.513
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|23097310|ref|NP_689523.1| elongation of very long chain fatty acids protein 3 [Homo sapiens]
MVTAMNVSHEVNQLFQPYNFELSKDMRPFFEEYWATSFPIALIYLVLIAVGQNYMKERKG
FNLQGPLILW
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9HB03
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18047
References
General References Not Available