| Identification |
| HMDB Protein ID
| HMDBP11786 |
| Secondary Accession Numbers
| None |
| Name
| HRAS-like suppressor 2 |
| Synonyms
|
Not Available
|
| Gene Name
| HRASLS2 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Exhibits PLA1/2 activity, catalyzing the calcium-independent hydrolysis of acyl groups in various phosphotidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. Catalyzes N-acylation of PE using both sn-1 and sn-2 palmitoyl groups of PC as acyl donor. Also catalyzes O-acylation converting lyso-PC into PC.
|
| Pathways
|
Not Available
|
| Reactions
|
| Phosphatidylcholine + Water → 1-acylglycerophosphocholine + a carboxylate |
details
|
| Phosphatidylcholine + Water → 2-acylglycerophosphocholine + a carboxylate |
details
|
| Phosphatidylcholine + O-Phosphoethanolamine → 1-acylglycerophosphocholine + N-palmitoyl-phosphoethanolamine |
details
|
|
| GO Classification
|
| Biological Process |
| lipid catabolic process |
| Cellular Component |
| cytoplasm |
| integral to membrane |
| Molecular Function |
| transferase activity, transferring acyl groups |
| hydrolase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 11 |
| Locus
| 11q12.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 17393.695 |
| Theoretical pI
| 9.267 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|8923526|ref|NP_060348.1| HRAS-like suppressor 2 [Homo sapiens]
MALARPRPRLGDLIEISRFGYAHWAIYVGDGYVVHLAPASEIAGAGAASVLSALTNKAIV
KKELLSVVAG
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NWW9 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:17824 |
| References |
| General References
| Not Available |