| Identification |
| HMDB Protein ID
| HMDBP11796 |
| Secondary Accession Numbers
| None |
| Name
| Interferon-induced helicase C domain-containing protein 1 |
| Synonyms
|
- Clinically amyopathic dermatomyositis autoantigen 140 kDa
- Helicase with 2 CARD domains
- Interferon-induced with helicase C domain protein 1
- Melanoma differentiation-associated protein 5
- Murabutide down-regulated protein
- RIG-I-like receptor 2
- RNA helicase-DEAD box protein 116
- CADM-140 autoantigen
- Helicard
- MDA-5
- RLR-2
|
| Gene Name
| IFIH1 |
| Protein Type
| Unknown |
| Biological Properties |
| General Function
| Not Available |
| Specific Function
| Innate immune receptor which acts as a cytoplasmic sensor of viral nucleic acids and plays a major role in sensing viral infection and in the activation of a cascade of antiviral responses including the induction of type I interferons and proinflammatory cytokines. Its ligands include mRNA lacking 2'-O-methylation at their 5' cap and long-dsRNA (>1 kb in length). Upon ligand binding it associates with mitochondria antiviral signaling protein (MAVS/IPS1) which activates the IKK-related kinases: TBK1 and IKBKE which phosphorylate interferon regulatory factors: IRF3 and IRF7 which in turn activate transcription of antiviral immunological genes, including interferons (IFNs); IFN-alpha and IFN-beta. Responsible for detecting the Picornaviridae family members such as encephalomyocarditis virus (EMCV) and mengo encephalomyocarditis virus (ENMG). Can also detect other viruses such as dengue virus (DENV), west Nile virus (WNV), and reovirus. Also involved in antiviral signaling in response to viruses containing a dsDNA genome, such as vaccinia virus. Plays an important role in amplifying innate immune signaling through recognition of RNA metabolites that are produced during virus infection by ribonuclease L (RNase L). May play an important role in enhancing natural killer cell function and may be involved in growth inhibition and apoptosis in several tumor cell lines.
|
| Pathways
|
- Hepatitis B
- Herpes simplex virus 1 infection
- Influenza A
- Measles
- RIG-I-like receptor signaling pathway
|
| Reactions
|
| Adenosine triphosphate + Water → ADP + Phosphate |
details
|
|
| GO Classification
|
| Biological Process |
| positive regulation of interferon-beta production |
| cytoplasmic pattern recognition receptor signaling pathway in response to virus |
| detection of virus |
| negative regulation of type I interferon production |
| positive regulation of interferon-alpha production |
| regulation of type III interferon production |
| innate immune response |
| virus-host interaction |
| regulation of apoptotic process |
| protein sumoylation |
| Cellular Component |
| cytosol |
| nucleus |
| Molecular Function |
| metal ion binding |
| double-stranded RNA binding |
| ATP binding |
| single-stranded RNA binding |
| zinc ion binding |
| ribonucleoprotein complex binding |
| DNA binding |
| helicase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
| Chromosome Location
| 2 |
| Locus
| 2q24 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
| Number of Residues
| Not Available |
| Molecular Weight
| 116688.14 |
| Theoretical pI
| 5.521 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|27886568|ref|NP_071451.2| interferon-induced helicase C domain-containing protein 1 [Homo sapiens]
MSNGYSTDENFRYLISCFRARVKMYIQVEPVLDYLTFLPAEVKEQIQRTVATSGNMQAVE
LLLSTLEKGV
|
| External Links |
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9BYX4 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
|
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:18873 |
| References |
| General References
| Not Available |